Annotation Detail for KIAA1609
Basic Information Top
Gene Symbol: | KIAA1609 ( MGC25024 ) |
---|---|
Gene Full Name: | KIAA1609 |
Band: | 16q24.1 |
Quick Links | Entrez ID:57707; OMIM: NA; Uniprot ID:K1609_HUMAN; ENSEMBL ID: ENSG00000140950; HGNC ID: |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.288274
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 2 / 70761 | 28 | |
blastocyst | 1 / 62319 | 16 | |
fetus | 47 / 564012 | 83 | |
neonate | 2 / 31097 | 64 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 80 / 1939121 | 41 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 8 / 94178 | 84 | |
cervical tumor | 1 / 34366 | 29 | |
chondrosarcoma | 1 / 82823 | 12 | |
colorectal tumor | 1 / 114246 | 8 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 2 / 119369 | 16 | |
germ cell tumor | 11 / 263845 | 41 | |
glioma | 1 / 106883 | 9 | |
head and neck tumor | 9 / 136302 | 66 | |
kidney tumor | 2 / 68959 | 29 | |
leukemia | 1 / 95842 | 10 | |
liver tumor | 2 / 96359 | 20 | |
lung tumor | 2 / 103127 | 19 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 1 / 97250 | 10 | |
normal | 124 / 3360307 | 36 | |
ovarian tumor | 2 / 76682 | 26 | |
pancreatic tumor | 1 / 104616 | 9 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 5 / 102680 | 48 | |
retinoblastoma | 1 / 46356 | 21 | |
skin tumor | 2 / 124949 | 16 | |
soft tissue/muscle tissue tumor | 3 / 125191 | 23 | |
uterine tumor | 1 / 90257 | 11 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 1 / 123478 | 8 | |
bone | 1 / 71655 | 13 | |
bone marrow | 0 / 48801 | 0 | |
brain | 34 / 1100989 | 30 | |
cervix | 5 / 48171 | 103 | |
connective tissue | 5 / 149255 | 33 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 5 / 215722 | 23 | |
esophagus | 0 / 20209 | 0 | |
eye | 10 / 211054 | 47 | |
heart | 7 / 89626 | 78 | |
intestine | 3 / 234472 | 12 | |
kidney | 5 / 211777 | 23 | |
larynx | 2 / 24145 | 82 | |
liver | 3 / 207743 | 14 | |
lung | 13 / 336974 | 38 | |
lymph | 0 / 44270 | 0 | |
lymph node | 2 / 91610 | 21 | |
mammary gland | 12 / 153271 | 78 | |
mouth | 4 / 67052 | 59 | |
muscle | 3 / 107715 | 27 | |
nerve | 0 / 15768 | 0 | |
ovary | 3 / 102051 | 29 | |
pancreas | 1 / 214812 | 4 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 3 / 41328 | 72 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 14 / 280825 | 49 | |
prostate | 8 / 189345 | 42 | |
salivary gland | 0 / 20155 | 0 | |
skin | 10 / 210574 | 47 | |
spleen | 1 / 53952 | 18 | |
stomach | 1 / 96619 | 10 | |
testis | 9 / 330442 | 27 | |
thymus | 4 / 81131 | 49 | |
thyroid | 2 / 47473 | 42 | |
tonsil | 0 / 16999 | 0 | |
trachea | 2 / 52413 | 38 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 9 / 232878 | 38 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 65438_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 10.9 | |
Adipocyte | 9.05 | |
AdrenalCortex | 13.95 | |
Adrenalgland | 8.25 | |
Amygdala | 8.5 | |
Appendix | 12.2 | |
AtrioventricularNode | 13.1 | |
BDCA4+_DentriticCells | 9.25 | |
Bonemarrow | 10.3 | |
BronchialEpithelialCells | 11.6 | |
CD105+_Endothelial | 8.95 | |
CD14+_Monocytes | 9.95 | |
CD19+_BCells(neg._sel.) | 9.85 | |
CD33+_Myeloid | 11.5 | |
CD34+ | 11 | |
CD4+_Tcells | 9.85 | |
CD56+_NKCells | 9.5 | |
CD71+_EarlyErythroid | 8.8 | |
CD8+_Tcells | 9 | |
CardiacMyocytes | 13.35 | |
Caudatenucleus | 8.2 | |
Cerebellum | 7.5 | |
CerebellumPeduncles | 11.8 | |
CiliaryGanglion | 8.4 | |
CingulateCortex | 9.85 | |
Colorectaladenocarcinoma | 9.4 | |
DorsalRootGanglion | 9.9 | |
FetalThyroid | 12.15 | |
Fetalbrain | 8.9 | |
Fetalliver | 8.05 | |
Fetallung | 7.05 | |
GlobusPallidus | 7.95 | |
Heart | 15.45 | |
Hypothalamus | 9.3 | |
Kidney | 9.15 | |
Leukemia_chronicMyelogenousK-562 | 8.85 | |
Leukemia_promyelocytic-HL-60 | 8.1 | |
Leukemialymphoblastic(MOLT-4) | 7.1 | |
Liver | 13.7 | |
Lung | 9.8 | |
Lymphnode | 7.55 | |
Lymphoma_burkitts(Daudi) | 12.5 | |
Lymphoma_burkitts(Raji) | 13.75 | |
MedullaOblongata | 8.3 | |
OccipitalLobe | 8.15 | |
OlfactoryBulb | 7.15 | |
Ovary | 7.95 | |
Pancreas | 8.2 | |
PancreaticIslet | 10.1 | |
ParietalLobe | 10.85 | |
Pituitary | 10.65 | |
Placenta | 9.3 | |
Pons | 9.75 | |
PrefrontalCortex | 10.95 | |
Prostate | 10.2 | |
Salivarygland | 8.7 | |
SkeletalMuscle | 16.75 | |
Skin | 11.4 | |
SmoothMuscle | 10.4 | |
Spinalcord | 9.35 | |
SubthalamicNucleus | 9.25 | |
SuperiorCervicalGanglion | 20 | |
TemporalLobe | 8.75 | |
Testis | 7.8 | |
TestisGermCell | 7.6 | |
TestisIntersitial | 8.65 | |
TestisLeydigCell | 10.55 | |
TestisSeminiferousTubule | 7.95 | |
Thalamus | 9.6 | |
Thymus | 6.55 | |
Thyroid | 10.8 | |
Tongue | 14.9 | |
Tonsil | 9.2 | |
Trachea | 7.4 | |
TrigeminalGanglion | 13.4 | |
Uterus | 7.2 | |
UterusCorpus | 10.55 | |
WholeBlood | 9.9 | |
Wholebrain | 7.25 | |
colon | 8.8 | |
pineal_day | 10.92 | |
pineal_night | 10.46 | |
retina | 11.05 | |
small_intestine | 8.5 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_32_P182511
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.91 ± 0.66 | |
Basal Forebrain | 3.76 ± 0.39 | |
Basal Part of Pons | 3.51 ± 0.46 | |
Cerebellar Cortex | 3.92 ± 0.53 | |
Cerebellar Nuclei | 3.57 ± 0.41 | |
Claustrum | 3.6 ± 0.47 | |
Epithalamus | 3.52 ± 0.66 | |
Frontal Lobe | 3.86 ± 0.61 | |
Globus Pallidus | 3.76 ± 0.42 | |
Hypothalamus | 3.56 ± 0.46 | |
Insula | 3.5 ± 0.44 | |
Limbic Lobe | 4.08 ± 0.65 | |
Mesencephalon | 3.83 ± 0.72 | |
Myelencephalon | 3.93 ± 0.6 | |
Occipital Lobe | 4.11 ± 0.48 | |
Parietal Lobe | 3.81 ± 0.58 | |
Pontine Tegmentum | 3.86 ± 0.56 | |
Striatum | 3.9 ± 0.75 | |
Subthalamus | 4.02 ± 1.16 | |
Temporal Lobe | 3.89 ± 0.57 | |
Thalamus | 3.8 ± 0.52 | |
White Matter | 2.57 ± 0.75 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
4632415K11Rik | CB | Cerebellum | 1.71 | |
2.09 | ||||
4632415K11Rik | CTX | Cerebral cortex | 7.06 | |
4.79 | ||||
4632415K11Rik | HIP | Hippocampal region | 13.62 | |
12.14 | ||||
4632415K11Rik | HPF | Hippocampal formation | 10.77 | |
8.97 | ||||
4632415K11Rik | HY | Hypothalamus | 0.71 | |
0.49 | ||||
4632415K11Rik | LSX | Lateral septal complex | 2.85 | |
1.69 | ||||
4632415K11Rik | MB | Midbrain | 1.09 | |
1.28 | ||||
4632415K11Rik | MY | Medulla | 1.52 | |
2.29 | ||||
4632415K11Rik | OLF | Olfactory bulb | 3.88 | |
2.51 | ||||
4632415K11Rik | P | Pons | 2.1 | |
3.18 | ||||
4632415K11Rik | PAL | Pallidum | 1.49 | |
1.16 | ||||
4632415K11Rik | RHP | Retrohippocampal region | 5.37 | |
4.09 | ||||
4632415K11Rik | sAMY | Striatum-like amygdalar nuclei | 5.5 | |
3.8 | ||||
4632415K11Rik | STR | Striatum | 2.57 | |
1.76 | ||||
4632415K11Rik | STRd | Striatum dorsal region | 2.38 | |
1.7 | ||||
4632415K11Rik | STRv | Striatum ventral region | 1.71 | |
1.11 | ||||
4632415K11Rik | TH | Thalamus | 2.06 | |
1.57 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00007079 | 33 | 11 | 43 | SFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSK | Peptide Atlas |