Annotation Detail for PTPRK
Basic Information Top
Gene Symbol: | PTPRK ( DKFZp686C2268,DKFZp779N1045,R-PTP-kappa ) |
---|---|
Gene Full Name: | protein tyrosine phosphatase, receptor type, K |
Band: | 6q22.33 |
Quick Links | Entrez ID:5796; OMIM: 602545; Uniprot ID:PTPRK_HUMAN; ENSEMBL ID: ENSG00000152894; HGNC ID: 9674 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.155919
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 5 / 70761 | 70 | |
blastocyst | 6 / 62319 | 96 | |
fetus | 41 / 564012 | 72 | |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 1 / 55556 | 17 | |
adult | 94 / 1939121 | 48 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 1 / 17475 | 57 | |
breast (mammary gland) tumor | 3 / 94178 | 31 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 3 / 82823 | 36 | |
colorectal tumor | 12 / 114246 | 105 | |
esophageal tumor | 1 / 17290 | 57 | |
gastrointestinal tumor | 4 / 119369 | 33 | |
germ cell tumor | 11 / 263845 | 41 | |
glioma | 8 / 106883 | 74 | |
head and neck tumor | 19 / 136302 | 139 | |
kidney tumor | 1 / 68959 | 14 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 1 / 96359 | 10 | |
lung tumor | 3 / 103127 | 29 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 2 / 97250 | 20 | |
normal | 148 / 3360307 | 44 | |
ovarian tumor | 2 / 76682 | 26 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | |
prostate cancer | 1 / 102680 | 9 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 1 / 124949 | 8 | |
soft tissue/muscle tissue tumor | 4 / 125191 | 31 | |
uterine tumor | 6 / 90257 | 66 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 1 / 13106 | 76 | |
adrenal gland | 1 / 33197 | 30 | |
ascites | 0 / 40015 | 0 | |
bladder | 2 / 29757 | 67 | |
blood | 0 / 123478 | 0 | |
bone | 3 / 71655 | 41 | |
bone marrow | 0 / 48801 | 0 | |
brain | 48 / 1100989 | 43 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 4 / 149255 | 26 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 18 / 215722 | 83 | |
esophagus | 1 / 20209 | 49 | |
eye | 3 / 211054 | 14 | |
heart | 4 / 89626 | 44 | |
intestine | 21 / 234472 | 89 | |
kidney | 14 / 211777 | 66 | |
larynx | 2 / 24145 | 82 | |
liver | 7 / 207743 | 33 | |
lung | 17 / 336974 | 50 | |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 8 / 153271 | 52 | |
mouth | 6 / 67052 | 89 | |
muscle | 2 / 107715 | 18 | |
nerve | 0 / 15768 | 0 | |
ovary | 3 / 102051 | 29 | |
pancreas | 9 / 214812 | 41 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 11 / 41328 | 266 | |
pituitary gland | 1 / 16585 | 60 | |
placenta | 9 / 280825 | 32 | |
prostate | 3 / 189345 | 15 | |
salivary gland | 0 / 20155 | 0 | |
skin | 5 / 210574 | 23 | |
spleen | 0 / 53952 | 0 | |
stomach | 4 / 96619 | 41 | |
testis | 4 / 330442 | 12 | |
thymus | 1 / 81131 | 12 | |
thyroid | 1 / 47473 | 21 | |
tonsil | 1 / 16999 | 58 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 9 / 232878 | 38 | |
vascular | 3 / 51780 | 57 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 203038_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 24.65 | |
Adipocyte | 5.1 | |
AdrenalCortex | 3.9 | |
Adrenalgland | 3.2 | |
Amygdala | 100.05 | |
Appendix | 4.55 | |
AtrioventricularNode | 3.45 | |
BDCA4+_DentriticCells | 3.9 | |
Bonemarrow | 3.4 | |
BronchialEpithelialCells | 275.7 | |
CD105+_Endothelial | 3.8 | |
CD14+_Monocytes | 3.75 | |
CD19+_BCells(neg._sel.) | 94.25 | |
CD33+_Myeloid | 4.6 | |
CD34+ | 5.25 | |
CD4+_Tcells | 3.9 | |
CD56+_NKCells | 4.05 | |
CD71+_EarlyErythroid | 3.45 | |
CD8+_Tcells | 4.4 | |
CardiacMyocytes | 15.75 | |
Caudatenucleus | 21.65 | |
Cerebellum | 3.4 | |
CerebellumPeduncles | 7.1 | |
CiliaryGanglion | 4.8 | |
CingulateCortex | 75.6 | |
Colorectaladenocarcinoma | 4.2 | |
DorsalRootGanglion | 3.3 | |
FetalThyroid | 4.9 | |
Fetalbrain | 317.85 | |
Fetalliver | 16.2 | |
Fetallung | 151.85 | |
GlobusPallidus | 53.85 | |
Heart | 4.25 | |
Hypothalamus | 116.1 | |
Kidney | 3.65 | |
Leukemia_chronicMyelogenousK-562 | 3.25 | |
Leukemia_promyelocytic-HL-60 | 3.2 | |
Leukemialymphoblastic(MOLT-4) | 44.75 | |
Liver | 5.5 | |
Lung | 10.6 | |
Lymphnode | 7.65 | |
Lymphoma_burkitts(Daudi) | 4.4 | |
Lymphoma_burkitts(Raji) | 5.6 | |
MedullaOblongata | 61.65 | |
OccipitalLobe | 98.75 | |
OlfactoryBulb | 4.1 | |
Ovary | 4.25 | |
Pancreas | 38.7 | |
PancreaticIslet | 65.5 | |
ParietalLobe | 81 | |
Pituitary | 11.8 | |
Placenta | 14 | |
Pons | 21.25 | |
PrefrontalCortex | 336.5 | |
Prostate | 46.4 | |
Salivarygland | 45.25 | |
SkeletalMuscle | 3.95 | |
Skin | 4.2 | |
SmoothMuscle | 75.7 | |
Spinalcord | 49 | |
SubthalamicNucleus | 55.4 | |
SuperiorCervicalGanglion | 4.4 | |
TemporalLobe | 37.15 | |
Testis | 3.15 | |
TestisGermCell | 3.4 | |
TestisIntersitial | 3.2 | |
TestisLeydigCell | 3.55 | |
TestisSeminiferousTubule | 3.15 | |
Thalamus | 31.8 | |
Thymus | 3.65 | |
Thyroid | 8.85 | |
Tongue | 4.25 | |
Tonsil | 4.45 | |
Trachea | 20.2 | |
TrigeminalGanglion | 3.9 | |
Uterus | 30.95 | |
UterusCorpus | 4.05 | |
WholeBlood | 3.85 | |
Wholebrain | 48.65 | |
colon | 95.45 | |
pineal_day | 4.84 | |
pineal_night | 4.5 | |
retina | 36.075 | |
small_intestine | 51 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_32_P99100
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 10.12 ± 0.42 | |
Basal Forebrain | 9.64 ± 0.25 | |
Basal Part of Pons | 9.91 ± 0.33 | |
Cerebellar Cortex | 9.64 ± 0.24 | |
Cerebellar Nuclei | 10.54 ± 0.19 | |
Claustrum | 10.36 ± 0.29 | |
Epithalamus | 10 ± 0.37 | |
Frontal Lobe | 10.36 ± 0.33 | |
Globus Pallidus | 10.25 ± 0.51 | |
Hypothalamus | 9.86 ± 0.34 | |
Insula | 10.2 ± 0.31 | |
Limbic Lobe | 10.11 ± 0.64 | |
Mesencephalon | 9.96 ± 0.51 | |
Myelencephalon | 10.03 ± 0.5 | |
Occipital Lobe | 9.83 ± 0.5 | |
Parietal Lobe | 10.23 ± 0.47 | |
Pontine Tegmentum | 10.32 ± 0.35 | |
Striatum | 9.31 ± 0.79 | |
Subthalamus | 10.49 ± 0.4 | |
Temporal Lobe | 10.15 ± 0.3 | |
Thalamus | 9.78 ± 0.37 | |
White Matter | 11.18 ± 0.17 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Ptprk | CB | Cerebellum | 12.34 | |
12.74 | ||||
Ptprk | CTX | Cerebral cortex | 64.05 | |
54.44 | ||||
Ptprk | HIP | Hippocampal region | 30.29 | |
43.17 | ||||
Ptprk | HPF | Hippocampal formation | 42.36 | |
53.34 | ||||
Ptprk | HY | Hypothalamus | 13.09 | |
10.56 | ||||
Ptprk | LSX | Lateral septal complex | 9.31 | |
7.99 | ||||
Ptprk | MB | Midbrain | 12.9 | |
12.01 | ||||
Ptprk | MY | Medulla | 12.42 | |
12.3 | ||||
Ptprk | OLF | Olfactory bulb | 56.12 | |
51.44 | ||||
Ptprk | P | Pons | 9.67 | |
9.09 | ||||
Ptprk | PAL | Pallidum | 8.27 | |
7.03 | ||||
Ptprk | RHP | Retrohippocampal region | 58.86 | |
63.96 | ||||
Ptprk | sAMY | Striatum-like amygdalar nuclei | 9.62 | |
6.74 | ||||
Ptprk | STR | Striatum | 4.94 | |
4.39 | ||||
Ptprk | STRd | Striatum dorsal region | 3.63 | |
3.41 | ||||
Ptprk | STRv | Striatum ventral region | 5.22 | |
5.14 | ||||
Ptprk | TH | Thalamus | 6.34 | |
6.47 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00040148 | 37 | 290 | 326 | EPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILK | Peptide Atlas |
PTPRK_HUMAN_792 | 12 | 792 | 803 | QEMTHMVNAMDR | PRIDE |