Annotation Detail for PTPRN2


Gene Symbol: | PTPRN2 ( IA-2beta,IAR,ICAAR,PTPRP ) |
---|---|
Gene Full Name: | protein tyrosine phosphatase, receptor type, N polypeptide 2 |
Band: | 7q36.3 |
Quick Links | Entrez ID:5799; OMIM: 601698; Uniprot ID:PTPR2_HUMAN; ENSEMBL ID: ENSG00000155093; HGNC ID: 9677 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.490789
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 1 / 70761 | 14 | ![]() |
blastocyst | 1 / 62319 | 16 | ![]() |
fetus | 36 / 564012 | 63 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 2 / 23620 | 84 | ![]() |
juvenile | 4 / 55556 | 71 | ![]() |
adult | 130 / 1939121 | 67 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 4 / 94178 | 42 | ![]() |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 1 / 82823 | 12 | ![]() |
colorectal tumor | 3 / 114246 | 26 | ![]() |
esophageal tumor | 1 / 17290 | 57 | ![]() |
gastrointestinal tumor | 4 / 119369 | 33 | ![]() |
germ cell tumor | 5 / 263845 | 18 | ![]() |
glioma | 10 / 106883 | 93 | ![]() |
head and neck tumor | 3 / 136302 | 22 | ![]() |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 10 / 97250 | 102 | ![]() |
normal | 287 / 3360307 | 85 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 4 / 104616 | 38 | ![]() |
primitive neuroectodermal tumor of the CNS | 7 / 125680 | 55 | ![]() |
prostate cancer | 2 / 102680 | 19 | ![]() |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 2 / 124949 | 16 | ![]() |
soft tissue/muscle tissue tumor | 4 / 125191 | 31 | ![]() |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 4 / 33197 | 120 | ![]() |
ascites | 0 / 40015 | 0 | |
bladder | 1 / 29757 | 33 | ![]() |
blood | 3 / 123478 | 24 | ![]() |
bone | 0 / 71655 | 0 | |
bone marrow | 1 / 48801 | 20 | ![]() |
brain | 182 / 1100989 | 165 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 6 / 149255 | 40 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 4 / 215722 | 18 | ![]() |
esophagus | 1 / 20209 | 49 | ![]() |
eye | 10 / 211054 | 47 | ![]() |
heart | 0 / 89626 | 0 | |
intestine | 9 / 234472 | 38 | ![]() |
kidney | 8 / 211777 | 37 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 1 / 207743 | 4 | ![]() |
lung | 17 / 336974 | 50 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 3 / 91610 | 32 | ![]() |
mammary gland | 4 / 153271 | 26 | ![]() |
mouth | 1 / 67052 | 14 | ![]() |
muscle | 0 / 107715 | 0 | |
nerve | 2 / 15768 | 126 | ![]() |
ovary | 1 / 102051 | 9 | ![]() |
pancreas | 31 / 214812 | 144 | ![]() |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 2 / 41328 | 48 | ![]() |
pituitary gland | 5 / 16585 | 301 | ![]() |
placenta | 9 / 280825 | 32 | ![]() |
prostate | 9 / 189345 | 47 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 2 / 210574 | 9 | ![]() |
spleen | 7 / 53952 | 129 | ![]() |
stomach | 5 / 96619 | 51 | ![]() |
testis | 17 / 330442 | 51 | ![]() |
thymus | 1 / 81131 | 12 | ![]() |
thyroid | 2 / 47473 | 42 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 2 / 52413 | 38 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 3 / 232878 | 12 | ![]() |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 203029_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 9.25 | ![]() |
Adipocyte | 8.6 | ![]() |
AdrenalCortex | 10.85 | ![]() |
Adrenalgland | 8.8 | ![]() |
Amygdala | 422.85 | ![]() |
Appendix | 12.15 | ![]() |
AtrioventricularNode | 9.45 | ![]() |
BDCA4+_DentriticCells | 7 | ![]() |
Bonemarrow | 10.5 | ![]() |
BronchialEpithelialCells | 9.35 | ![]() |
CD105+_Endothelial | 8.4 | ![]() |
CD14+_Monocytes | 10.8 | ![]() |
CD19+_BCells(neg._sel.) | 22.65 | ![]() |
CD33+_Myeloid | 9.75 | ![]() |
CD34+ | 9.3 | ![]() |
CD4+_Tcells | 7.85 | ![]() |
CD56+_NKCells | 15.4 | ![]() |
CD71+_EarlyErythroid | 7.35 | ![]() |
CD8+_Tcells | 6.9 | ![]() |
CardiacMyocytes | 11.15 | ![]() |
Caudatenucleus | 273.55 | ![]() |
Cerebellum | 36.2 | ![]() |
CerebellumPeduncles | 73.1 | ![]() |
CiliaryGanglion | 8 | ![]() |
CingulateCortex | 178.9 | ![]() |
Colorectaladenocarcinoma | 123.4 | ![]() |
DorsalRootGanglion | 9.25 | ![]() |
FetalThyroid | 11 | ![]() |
Fetalbrain | 162.6 | ![]() |
Fetalliver | 8.05 | ![]() |
Fetallung | 8.45 | ![]() |
GlobusPallidus | 85.9 | ![]() |
Heart | 11.7 | ![]() |
Hypothalamus | 298.5 | ![]() |
Kidney | 7.25 | ![]() |
Leukemia_chronicMyelogenousK-562 | 8.1 | ![]() |
Leukemia_promyelocytic-HL-60 | 7.75 | ![]() |
Leukemialymphoblastic(MOLT-4) | 53.75 | ![]() |
Liver | 13.15 | ![]() |
Lung | 26.65 | ![]() |
Lymphnode | 9.4 | ![]() |
Lymphoma_burkitts(Daudi) | 10.35 | ![]() |
Lymphoma_burkitts(Raji) | 12.85 | ![]() |
MedullaOblongata | 128.35 | ![]() |
OccipitalLobe | 258.6 | ![]() |
OlfactoryBulb | 14.65 | ![]() |
Ovary | 8.15 | ![]() |
Pancreas | 19.25 | ![]() |
PancreaticIslet | 126.05 | ![]() |
ParietalLobe | 190 | ![]() |
Pituitary | 168.55 | ![]() |
Placenta | 8.5 | ![]() |
Pons | 35.8 | ![]() |
PrefrontalCortex | 322.35 | ![]() |
Prostate | 71.3 | ![]() |
Salivarygland | 7.7 | ![]() |
SkeletalMuscle | 9.85 | ![]() |
Skin | 7.8 | ![]() |
SmoothMuscle | 10.3 | ![]() |
Spinalcord | 46.95 | ![]() |
SubthalamicNucleus | 228.9 | ![]() |
SuperiorCervicalGanglion | 15.35 | ![]() |
TemporalLobe | 144.6 | ![]() |
Testis | 8.15 | ![]() |
TestisGermCell | 9.1 | ![]() |
TestisIntersitial | 7 | ![]() |
TestisLeydigCell | 10.7 | ![]() |
TestisSeminiferousTubule | 8.25 | ![]() |
Thalamus | 214.7 | ![]() |
Thymus | 7 | ![]() |
Thyroid | 38.7 | ![]() |
Tongue | 9.75 | ![]() |
Tonsil | 8.8 | ![]() |
Trachea | 38.35 | ![]() |
TrigeminalGanglion | 11.85 | ![]() |
Uterus | 7.75 | ![]() |
UterusCorpus | 10.55 | ![]() |
WholeBlood | 10.85 | ![]() |
Wholebrain | 526.65 | ![]() |
colon | 12.2 | ![]() |
pineal_day | 85.3 | ![]() |
pineal_night | 106.44 | ![]() |
retina | 51.125 | ![]() |
small_intestine | 10.4 | ![]() |
- Probe name: A_32_P66804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 10.48 ± 0.47 | ![]() ![]() ![]() |
Basal Forebrain | 9.83 ± 0.27 | ![]() ![]() ![]() |
Basal Part of Pons | 9.71 ± 0.47 | ![]() ![]() ![]() |
Cerebellar Cortex | 9.03 ± 0.29 | ![]() ![]() ![]() |
Cerebellar Nuclei | 8.79 ± 0.78 | ![]() ![]() ![]() |
Claustrum | 10.52 ± 0.59 | ![]() ![]() ![]() |
Epithalamus | 8.08 ± 1.02 | ![]() ![]() ![]() |
Frontal Lobe | 9.59 ± 0.67 | ![]() ![]() ![]() |
Globus Pallidus | 8.91 ± 0.98 | ![]() ![]() ![]() |
Hypothalamus | 9.45 ± 0.5 | ![]() ![]() ![]() |
Insula | 9.67 ± 0.39 | ![]() ![]() ![]() |
Limbic Lobe | 10.33 ± 0.52 | ![]() ![]() ![]() |
Mesencephalon | 9.58 ± 0.71 | ![]() ![]() ![]() |
Myelencephalon | 9.68 ± 0.71 | ![]() ![]() ![]() |
Occipital Lobe | 10.13 ± 0.62 | ![]() ![]() ![]() |
Parietal Lobe | 9.8 ± 0.73 | ![]() ![]() ![]() |
Pontine Tegmentum | 9.62 ± 0.59 | ![]() ![]() ![]() |
Striatum | 10.61 ± 0.41 | ![]() ![]() ![]() |
Subthalamus | 9.3 ± 0.02 | ![]() ![]() ![]() |
Temporal Lobe | 9.76 ± 0.54 | ![]() ![]() ![]() |
Thalamus | 9.74 ± 0.44 | ![]() ![]() ![]() |
White Matter | 7.51 ± 1.01 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Ptprn2 | CB | Cerebellum | 31.4 | ![]() |
46.07 | ![]() | |||
Ptprn2 | CTX | Cerebral cortex | 72.25 | ![]() |
57.24 | ![]() | |||
Ptprn2 | HIP | Hippocampal region | 43.3 | ![]() |
60.46 | ![]() | |||
Ptprn2 | HPF | Hippocampal formation | 58.64 | ![]() |
65.94 | ![]() | |||
Ptprn2 | HY | Hypothalamus | 29.53 | ![]() |
23.66 | ![]() | |||
Ptprn2 | LSX | Lateral septal complex | 34.45 | ![]() |
25.33 | ![]() | |||
Ptprn2 | MB | Midbrain | 38.03 | ![]() |
33.09 | ![]() | |||
Ptprn2 | MY | Medulla | 13.12 | ![]() |
12.46 | ![]() | |||
Ptprn2 | OLF | Olfactory bulb | 56.69 | ![]() |
47.42 | ![]() | |||
Ptprn2 | P | Pons | 23.7 | ![]() |
20.97 | ![]() | |||
Ptprn2 | PAL | Pallidum | 26.84 | ![]() |
22.59 | ![]() | |||
Ptprn2 | RHP | Retrohippocampal region | 85.69 | ![]() |
75.91 | ![]() | |||
Ptprn2 | sAMY | Striatum-like amygdalar nuclei | 38.82 | ![]() |
28.47 | ![]() | |||
Ptprn2 | STR | Striatum | 35.74 | ![]() |
26.97 | ![]() | |||
Ptprn2 | STRd | Striatum dorsal region | 31.37 | ![]() |
24.71 | ![]() | |||
Ptprn2 | STRv | Striatum ventral region | 46.38 | ![]() |
31.37 | ![]() | |||
Ptprn2 | TH | Thalamus | 57.27 | ![]() |
49 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PTPR2_HUMAN_673 | 35 | 673 | 707 | MATRPPDRPEGPHTSRISSVSSQFSDGPIPSPSAR | PRIDE |