Annotation Detail for ROBO1
Basic Information Top
| Gene Symbol: | ROBO1 ( DUTT1,FLJ21882,MGC131599,MGC133277,SAX3 ) |
|---|---|
| Gene Full Name: | roundabout, axon guidance receptor, homolog 1 (Drosophila) |
| Band: | 3p12.3 |
| Quick Links | Entrez ID:6091; OMIM: 602430; Uniprot ID:ROBO1_HUMAN; ENSEMBL ID: ENSG00000169855; HGNC ID: 10249 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.13640
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 7 / 70761 | 98 | |
| blastocyst | 5 / 62319 | 80 | |
| fetus | 35 / 564012 | 62 | |
| neonate | 0 / 31097 | 0 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 2 / 55556 | 35 | |
| adult | 63 / 1939121 | 32 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 4 / 94178 | 42 | |
| cervical tumor | 1 / 34366 | 29 | |
| chondrosarcoma | 1 / 82823 | 12 | |
| colorectal tumor | 1 / 114246 | 8 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 9 / 119369 | 75 | |
| germ cell tumor | 12 / 263845 | 45 | |
| glioma | 1 / 106883 | 9 | |
| head and neck tumor | 15 / 136302 | 110 | |
| kidney tumor | 0 / 68959 | 0 | |
| leukemia | 0 / 95842 | 0 | |
| liver tumor | 3 / 96359 | 31 | |
| lung tumor | 0 / 103127 | 0 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 1 / 97250 | 10 | |
| normal | 98 / 3360307 | 29 | |
| ovarian tumor | 2 / 76682 | 26 | |
| pancreatic tumor | 0 / 104616 | 0 | |
| primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | |
| prostate cancer | 0 / 102680 | 0 | |
| retinoblastoma | 1 / 46356 | 21 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
| uterine tumor | 1 / 90257 | 11 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 1 / 29757 | 33 | |
| blood | 1 / 123478 | 8 | |
| bone | 0 / 71655 | 0 | |
| bone marrow | 0 / 48801 | 0 | |
| brain | 45 / 1100989 | 40 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 2 / 149255 | 13 | |
| ear | 2 / 16212 | 123 | |
| embryonic tissue | 15 / 215722 | 69 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 3 / 211054 | 14 | |
| heart | 0 / 89626 | 0 | |
| intestine | 4 / 234472 | 17 | |
| kidney | 0 / 211777 | 0 | |
| larynx | 1 / 24145 | 41 | |
| liver | 3 / 207743 | 14 | |
| lung | 4 / 336974 | 11 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 8 / 153271 | 52 | |
| mouth | 14 / 67052 | 208 | |
| muscle | 3 / 107715 | 27 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 2 / 102051 | 19 | |
| pancreas | 0 / 214812 | 0 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 5 / 280825 | 17 | |
| prostate | 5 / 189345 | 26 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 2 / 210574 | 9 | |
| spleen | 1 / 53952 | 18 | |
| stomach | 6 / 96619 | 62 | |
| testis | 15 / 330442 | 45 | |
| thymus | 3 / 81131 | 36 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 2 / 52413 | 38 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 1 / 232878 | 4 | |
| vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 213194_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 107.5 | |
| Adipocyte | 13.75 | |
| AdrenalCortex | 19.6 | |
| Adrenalgland | 8.65 | |
| Amygdala | 28.35 | |
| Appendix | 12.5 | |
| AtrioventricularNode | 9.6 | |
| BDCA4+_DentriticCells | 8.05 | |
| Bonemarrow | 10.4 | |
| BronchialEpithelialCells | 15.6 | |
| CD105+_Endothelial | 9.2 | |
| CD14+_Monocytes | 9.1 | |
| CD19+_BCells(neg._sel.) | 9.15 | |
| CD33+_Myeloid | 9.85 | |
| CD34+ | 11.1 | |
| CD4+_Tcells | 8 | |
| CD56+_NKCells | 10.3 | |
| CD71+_EarlyErythroid | 8.85 | |
| CD8+_Tcells | 8.2 | |
| CardiacMyocytes | 47.9 | |
| Caudatenucleus | 11 | |
| Cerebellum | 8.25 | |
| CerebellumPeduncles | 12.15 | |
| CiliaryGanglion | 9.45 | |
| CingulateCortex | 11.8 | |
| Colorectaladenocarcinoma | 9.3 | |
| DorsalRootGanglion | 10.75 | |
| FetalThyroid | 10.4 | |
| Fetalbrain | 199.8 | |
| Fetalliver | 22.6 | |
| Fetallung | 13.3 | |
| GlobusPallidus | 8 | |
| Heart | 13.6 | |
| Hypothalamus | 44.95 | |
| Kidney | 8.5 | |
| Leukemia_chronicMyelogenousK-562 | 8.85 | |
| Leukemia_promyelocytic-HL-60 | 7.5 | |
| Leukemialymphoblastic(MOLT-4) | 6.9 | |
| Liver | 13.9 | |
| Lung | 9.75 | |
| Lymphnode | 13.1 | |
| Lymphoma_burkitts(Daudi) | 11.5 | |
| Lymphoma_burkitts(Raji) | 11.6 | |
| MedullaOblongata | 8.95 | |
| OccipitalLobe | 18.15 | |
| OlfactoryBulb | 7.4 | |
| Ovary | 7.9 | |
| Pancreas | 8.25 | |
| PancreaticIslet | 9.65 | |
| ParietalLobe | 15.4 | |
| Pituitary | 30.65 | |
| Placenta | 7.85 | |
| Pons | 15.5 | |
| PrefrontalCortex | 23.95 | |
| Prostate | 11.35 | |
| Salivarygland | 7.5 | |
| SkeletalMuscle | 14.85 | |
| Skin | 11.9 | |
| SmoothMuscle | 87.4 | |
| Spinalcord | 15.75 | |
| SubthalamicNucleus | 12.65 | |
| SuperiorCervicalGanglion | 16.4 | |
| TemporalLobe | 12.8 | |
| Testis | 8.15 | |
| TestisGermCell | 14.45 | |
| TestisIntersitial | 8.95 | |
| TestisLeydigCell | 10.35 | |
| TestisSeminiferousTubule | 8.6 | |
| Thalamus | 24.65 | |
| Thymus | 7.7 | |
| Thyroid | 10.1 | |
| Tongue | 13.5 | |
| Tonsil | 17.2 | |
| Trachea | 8.3 | |
| TrigeminalGanglion | 12.4 | |
| Uterus | 10.2 | |
| UterusCorpus | 9.65 | |
| WholeBlood | 8.45 | |
| Wholebrain | 8.55 | |
| colon | 9.95 | |
| pineal_day | 11.92 | |
| pineal_night | 11.66 | |
| retina | 16.65 | |
| small_intestine | 9.45 |
- Probe name: A_23_P80503
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 6.63 ± 0.46 | |
| Basal Forebrain | 6.57 ± 0.32 | |
| Basal Part of Pons | 5.53 ± 0.39 | |
| Cerebellar Cortex | 5.85 ± 0.26 | |
| Cerebellar Nuclei | 6.09 ± 0.37 | |
| Claustrum | 6.64 ± 0.74 | |
| Epithalamus | 5.56 ± 0.5 | |
| Frontal Lobe | 6.08 ± 0.44 | |
| Globus Pallidus | 6.8 ± 0.25 | |
| Hypothalamus | 5.83 ± 0.45 | |
| Insula | 6.29 ± 0.39 | |
| Limbic Lobe | 6.46 ± 0.5 | |
| Mesencephalon | 6.26 ± 0.46 | |
| Myelencephalon | 6.21 ± 0.53 | |
| Occipital Lobe | 6.18 ± 0.45 | |
| Parietal Lobe | 6.17 ± 0.52 | |
| Pontine Tegmentum | 6.51 ± 0.39 | |
| Striatum | 6.98 ± 0.47 | |
| Subthalamus | 6.38 ± 0.15 | |
| Temporal Lobe | 6.21 ± 0.42 | |
| Thalamus | 6.67 ± 0.4 | |
| White Matter | 6.7 ± 0.48 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Robo1 | CB | Cerebellum | 1.04 | |
| 1.82 | ||||
| Robo1 | CTX | Cerebral cortex | 10.04 | |
| 9.42 | ||||
| Robo1 | HIP | Hippocampal region | 28.41 | |
| 56.65 | ||||
| Robo1 | HPF | Hippocampal formation | 19.42 | |
| 33.11 | ||||
| Robo1 | HY | Hypothalamus | 6.19 | |
| 5.75 | ||||
| Robo1 | LSX | Lateral septal complex | 16.66 | |
| 15.27 | ||||
| Robo1 | MB | Midbrain | 11.52 | |
| 13.51 | ||||
| Robo1 | MY | Medulla | 3.96 | |
| 7.11 | ||||
| Robo1 | OLF | Olfactory bulb | 13.91 | |
| 14 | ||||
| Robo1 | P | Pons | 9.37 | |
| 13.04 | ||||
| Robo1 | PAL | Pallidum | 16.61 | |
| 16.94 | ||||
| Robo1 | RHP | Retrohippocampal region | 8.4 | |
| 8.77 | ||||
| Robo1 | sAMY | Striatum-like amygdalar nuclei | 8.19 | |
| 7.87 | ||||
| Robo1 | STR | Striatum | 20.51 | |
| 18.68 | ||||
| Robo1 | STRd | Striatum dorsal region | 8.97 | |
| 7.97 | ||||
| Robo1 | STRv | Striatum ventral region | 60.96 | |
| 51.8 | ||||
| Robo1 | TH | Thalamus | 16.77 | |
| 17.57 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00497573 | 32 | 828 | 859 | SEPQFIQLDAHGNPVSPEDQVSLAQQISDVVK | Peptide Atlas |
| ROBO1_HUMAN_453 | 6 | 453 | 458 | PPPVIR | PRIDE |



