Annotation Detail for ROBO1


Gene Symbol: | ROBO1 ( DUTT1,FLJ21882,MGC131599,MGC133277,SAX3 ) |
---|---|
Gene Full Name: | roundabout, axon guidance receptor, homolog 1 (Drosophila) |
Band: | 3p12.3 |
Quick Links | Entrez ID:6091; OMIM: 602430; Uniprot ID:ROBO1_HUMAN; ENSEMBL ID: ENSG00000169855; HGNC ID: 10249 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.13640
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 7 / 70761 | 98 | ![]() |
blastocyst | 5 / 62319 | 80 | ![]() |
fetus | 35 / 564012 | 62 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 2 / 55556 | 35 | ![]() |
adult | 63 / 1939121 | 32 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 4 / 94178 | 42 | ![]() |
cervical tumor | 1 / 34366 | 29 | ![]() |
chondrosarcoma | 1 / 82823 | 12 | ![]() |
colorectal tumor | 1 / 114246 | 8 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 9 / 119369 | 75 | ![]() |
germ cell tumor | 12 / 263845 | 45 | ![]() |
glioma | 1 / 106883 | 9 | ![]() |
head and neck tumor | 15 / 136302 | 110 | ![]() |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 3 / 96359 | 31 | ![]() |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 1 / 97250 | 10 | ![]() |
normal | 98 / 3360307 | 29 | ![]() |
ovarian tumor | 2 / 76682 | 26 | ![]() |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | ![]() |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 1 / 46356 | 21 | ![]() |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 1 / 90257 | 11 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 1 / 29757 | 33 | ![]() |
blood | 1 / 123478 | 8 | ![]() |
bone | 0 / 71655 | 0 | |
bone marrow | 0 / 48801 | 0 | |
brain | 45 / 1100989 | 40 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 2 / 149255 | 13 | ![]() |
ear | 2 / 16212 | 123 | ![]() |
embryonic tissue | 15 / 215722 | 69 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 3 / 211054 | 14 | ![]() |
heart | 0 / 89626 | 0 | |
intestine | 4 / 234472 | 17 | ![]() |
kidney | 0 / 211777 | 0 | |
larynx | 1 / 24145 | 41 | ![]() |
liver | 3 / 207743 | 14 | ![]() |
lung | 4 / 336974 | 11 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 8 / 153271 | 52 | ![]() |
mouth | 14 / 67052 | 208 | ![]() |
muscle | 3 / 107715 | 27 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 2 / 102051 | 19 | ![]() |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 5 / 280825 | 17 | ![]() |
prostate | 5 / 189345 | 26 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 2 / 210574 | 9 | ![]() |
spleen | 1 / 53952 | 18 | ![]() |
stomach | 6 / 96619 | 62 | ![]() |
testis | 15 / 330442 | 45 | ![]() |
thymus | 3 / 81131 | 36 | ![]() |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 2 / 52413 | 38 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 1 / 232878 | 4 | ![]() |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 213194_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 107.5 | ![]() |
Adipocyte | 13.75 | ![]() |
AdrenalCortex | 19.6 | ![]() |
Adrenalgland | 8.65 | ![]() |
Amygdala | 28.35 | ![]() |
Appendix | 12.5 | ![]() |
AtrioventricularNode | 9.6 | ![]() |
BDCA4+_DentriticCells | 8.05 | ![]() |
Bonemarrow | 10.4 | ![]() |
BronchialEpithelialCells | 15.6 | ![]() |
CD105+_Endothelial | 9.2 | ![]() |
CD14+_Monocytes | 9.1 | ![]() |
CD19+_BCells(neg._sel.) | 9.15 | ![]() |
CD33+_Myeloid | 9.85 | ![]() |
CD34+ | 11.1 | ![]() |
CD4+_Tcells | 8 | ![]() |
CD56+_NKCells | 10.3 | ![]() |
CD71+_EarlyErythroid | 8.85 | ![]() |
CD8+_Tcells | 8.2 | ![]() |
CardiacMyocytes | 47.9 | ![]() |
Caudatenucleus | 11 | ![]() |
Cerebellum | 8.25 | ![]() |
CerebellumPeduncles | 12.15 | ![]() |
CiliaryGanglion | 9.45 | ![]() |
CingulateCortex | 11.8 | ![]() |
Colorectaladenocarcinoma | 9.3 | ![]() |
DorsalRootGanglion | 10.75 | ![]() |
FetalThyroid | 10.4 | ![]() |
Fetalbrain | 199.8 | ![]() |
Fetalliver | 22.6 | ![]() |
Fetallung | 13.3 | ![]() |
GlobusPallidus | 8 | ![]() |
Heart | 13.6 | ![]() |
Hypothalamus | 44.95 | ![]() |
Kidney | 8.5 | ![]() |
Leukemia_chronicMyelogenousK-562 | 8.85 | ![]() |
Leukemia_promyelocytic-HL-60 | 7.5 | ![]() |
Leukemialymphoblastic(MOLT-4) | 6.9 | ![]() |
Liver | 13.9 | ![]() |
Lung | 9.75 | ![]() |
Lymphnode | 13.1 | ![]() |
Lymphoma_burkitts(Daudi) | 11.5 | ![]() |
Lymphoma_burkitts(Raji) | 11.6 | ![]() |
MedullaOblongata | 8.95 | ![]() |
OccipitalLobe | 18.15 | ![]() |
OlfactoryBulb | 7.4 | ![]() |
Ovary | 7.9 | ![]() |
Pancreas | 8.25 | ![]() |
PancreaticIslet | 9.65 | ![]() |
ParietalLobe | 15.4 | ![]() |
Pituitary | 30.65 | ![]() |
Placenta | 7.85 | ![]() |
Pons | 15.5 | ![]() |
PrefrontalCortex | 23.95 | ![]() |
Prostate | 11.35 | ![]() |
Salivarygland | 7.5 | ![]() |
SkeletalMuscle | 14.85 | ![]() |
Skin | 11.9 | ![]() |
SmoothMuscle | 87.4 | ![]() |
Spinalcord | 15.75 | ![]() |
SubthalamicNucleus | 12.65 | ![]() |
SuperiorCervicalGanglion | 16.4 | ![]() |
TemporalLobe | 12.8 | ![]() |
Testis | 8.15 | ![]() |
TestisGermCell | 14.45 | ![]() |
TestisIntersitial | 8.95 | ![]() |
TestisLeydigCell | 10.35 | ![]() |
TestisSeminiferousTubule | 8.6 | ![]() |
Thalamus | 24.65 | ![]() |
Thymus | 7.7 | ![]() |
Thyroid | 10.1 | ![]() |
Tongue | 13.5 | ![]() |
Tonsil | 17.2 | ![]() |
Trachea | 8.3 | ![]() |
TrigeminalGanglion | 12.4 | ![]() |
Uterus | 10.2 | ![]() |
UterusCorpus | 9.65 | ![]() |
WholeBlood | 8.45 | ![]() |
Wholebrain | 8.55 | ![]() |
colon | 9.95 | ![]() |
pineal_day | 11.92 | ![]() |
pineal_night | 11.66 | ![]() |
retina | 16.65 | ![]() |
small_intestine | 9.45 | ![]() |
- Probe name: A_23_P80503
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 6.63 ± 0.46 | ![]() ![]() ![]() |
Basal Forebrain | 6.57 ± 0.32 | ![]() ![]() ![]() |
Basal Part of Pons | 5.53 ± 0.39 | ![]() ![]() ![]() |
Cerebellar Cortex | 5.85 ± 0.26 | ![]() ![]() ![]() |
Cerebellar Nuclei | 6.09 ± 0.37 | ![]() ![]() ![]() |
Claustrum | 6.64 ± 0.74 | ![]() ![]() ![]() |
Epithalamus | 5.56 ± 0.5 | ![]() ![]() ![]() |
Frontal Lobe | 6.08 ± 0.44 | ![]() ![]() ![]() |
Globus Pallidus | 6.8 ± 0.25 | ![]() ![]() ![]() |
Hypothalamus | 5.83 ± 0.45 | ![]() ![]() ![]() |
Insula | 6.29 ± 0.39 | ![]() ![]() ![]() |
Limbic Lobe | 6.46 ± 0.5 | ![]() ![]() ![]() |
Mesencephalon | 6.26 ± 0.46 | ![]() ![]() ![]() |
Myelencephalon | 6.21 ± 0.53 | ![]() ![]() ![]() |
Occipital Lobe | 6.18 ± 0.45 | ![]() ![]() ![]() |
Parietal Lobe | 6.17 ± 0.52 | ![]() ![]() ![]() |
Pontine Tegmentum | 6.51 ± 0.39 | ![]() ![]() ![]() |
Striatum | 6.98 ± 0.47 | ![]() ![]() ![]() |
Subthalamus | 6.38 ± 0.15 | ![]() ![]() ![]() |
Temporal Lobe | 6.21 ± 0.42 | ![]() ![]() ![]() |
Thalamus | 6.67 ± 0.4 | ![]() ![]() ![]() |
White Matter | 6.7 ± 0.48 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Robo1 | CB | Cerebellum | 1.04 | ![]() |
1.82 | ![]() | |||
Robo1 | CTX | Cerebral cortex | 10.04 | ![]() |
9.42 | ![]() | |||
Robo1 | HIP | Hippocampal region | 28.41 | ![]() |
56.65 | ![]() | |||
Robo1 | HPF | Hippocampal formation | 19.42 | ![]() |
33.11 | ![]() | |||
Robo1 | HY | Hypothalamus | 6.19 | ![]() |
5.75 | ![]() | |||
Robo1 | LSX | Lateral septal complex | 16.66 | ![]() |
15.27 | ![]() | |||
Robo1 | MB | Midbrain | 11.52 | ![]() |
13.51 | ![]() | |||
Robo1 | MY | Medulla | 3.96 | ![]() |
7.11 | ![]() | |||
Robo1 | OLF | Olfactory bulb | 13.91 | ![]() |
14 | ![]() | |||
Robo1 | P | Pons | 9.37 | ![]() |
13.04 | ![]() | |||
Robo1 | PAL | Pallidum | 16.61 | ![]() |
16.94 | ![]() | |||
Robo1 | RHP | Retrohippocampal region | 8.4 | ![]() |
8.77 | ![]() | |||
Robo1 | sAMY | Striatum-like amygdalar nuclei | 8.19 | ![]() |
7.87 | ![]() | |||
Robo1 | STR | Striatum | 20.51 | ![]() |
18.68 | ![]() | |||
Robo1 | STRd | Striatum dorsal region | 8.97 | ![]() |
7.97 | ![]() | |||
Robo1 | STRv | Striatum ventral region | 60.96 | ![]() |
51.8 | ![]() | |||
Robo1 | TH | Thalamus | 16.77 | ![]() |
17.57 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00497573 | 32 | 828 | 859 | SEPQFIQLDAHGNPVSPEDQVSLAQQISDVVK | Peptide Atlas |
ROBO1_HUMAN_453 | 6 | 453 | 458 | PPPVIR | PRIDE |