Annotation Detail for RPS3A
Basic Information Top
Gene Symbol: | RPS3A ( FTE1,MFTL,MGC23240 ) |
---|---|
Gene Full Name: | ribosomal protein S3A |
Band: | 4q31.3 |
Quick Links | Entrez ID:6189; OMIM: 180478; Uniprot ID:RS3A_HUMAN; ENSEMBL ID: ENSG00000145425; HGNC ID: 10421 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.356572
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 137 / 70761 | 1936 | |
blastocyst | 169 / 62319 | 2711 | |
fetus | 296 / 564012 | 524 | |
neonate | 58 / 31097 | 1865 | |
infant | 6 / 23620 | 254 | |
juvenile | 55 / 55556 | 989 | |
adult | 1619 / 1939121 | 834 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 20 / 12794 | 1563 | |
bladder carcinoma | 8 / 17475 | 457 | |
breast (mammary gland) tumor | 124 / 94178 | 1316 | |
cervical tumor | 61 / 34366 | 1775 | |
chondrosarcoma | 113 / 82823 | 1364 | |
colorectal tumor | 214 / 114246 | 1873 | |
esophageal tumor | 4 / 17290 | 231 | |
gastrointestinal tumor | 174 / 119369 | 1457 | |
germ cell tumor | 405 / 263845 | 1534 | |
glioma | 77 / 106883 | 720 | |
head and neck tumor | 68 / 136302 | 498 | |
kidney tumor | 97 / 68959 | 1406 | |
leukemia | 50 / 95842 | 521 | |
liver tumor | 173 / 96359 | 1795 | |
lung tumor | 363 / 103127 | 3519 | |
lymphoma | 329 / 71755 | 4585 | |
non-neoplasia | 33 / 97250 | 339 | |
normal | 2946 / 3360307 | 876 | |
ovarian tumor | 191 / 76682 | 2490 | |
pancreatic tumor | 139 / 104616 | 1328 | |
primitive neuroectodermal tumor of the CNS | 326 / 125680 | 2593 | |
prostate cancer | 187 / 102680 | 1821 | |
retinoblastoma | 287 / 46356 | 6191 | |
skin tumor | 325 / 124949 | 2601 | |
soft tissue/muscle tissue tumor | 410 / 125191 | 3274 | |
uterine tumor | 221 / 90257 | 2448 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 24 / 13106 | 1831 | |
adrenal gland | 28 / 33197 | 843 | |
ascites | 62 / 40015 | 1549 | |
bladder | 20 / 29757 | 672 | |
blood | 104 / 123478 | 842 | |
bone | 122 / 71655 | 1702 | |
bone marrow | 66 / 48801 | 1352 | |
brain | 501 / 1100989 | 455 | |
cervix | 63 / 48171 | 1307 | |
connective tissue | 109 / 149255 | 730 | |
ear | 17 / 16212 | 1048 | |
embryonic tissue | 550 / 215722 | 2549 | |
esophagus | 4 / 20209 | 197 | |
eye | 468 / 211054 | 2217 | |
heart | 75 / 89626 | 836 | |
intestine | 274 / 234472 | 1168 | |
kidney | 109 / 211777 | 514 | |
larynx | 9 / 24145 | 372 | |
liver | 224 / 207743 | 1078 | |
lung | 446 / 336974 | 1323 | |
lymph | 274 / 44270 | 6189 | |
lymph node | 56 / 91610 | 611 | |
mammary gland | 133 / 153271 | 867 | |
mouth | 21 / 67052 | 313 | |
muscle | 241 / 107715 | 2237 | |
nerve | 10 / 15768 | 634 | |
ovary | 273 / 102051 | 2675 | |
pancreas | 546 / 214812 | 2541 | |
parathyroid | 5 / 20539 | 243 | |
pharynx | 79 / 41328 | 1911 | |
pituitary gland | 10 / 16585 | 602 | |
placenta | 291 / 280825 | 1036 | |
prostate | 256 / 189345 | 1352 | |
salivary gland | 29 / 20155 | 1438 | |
skin | 350 / 210574 | 1662 | |
spleen | 32 / 53952 | 593 | |
stomach | 157 / 96619 | 1624 | |
testis | 96 / 330442 | 290 | |
thymus | 37 / 81131 | 456 | |
thyroid | 31 / 47473 | 653 | |
tonsil | 343 / 16999 | 20177 | |
trachea | 2 / 52413 | 38 | |
umbilical cord | 57 / 13680 | 4166 | |
uterus | 435 / 232878 | 1867 | |
vascular | 43 / 51780 | 830 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201257_x_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 14922.5 | |
Adipocyte | 7790.65 | |
AdrenalCortex | 6381.45 | |
Adrenalgland | 3037.8 | |
Amygdala | 5919.75 | |
Appendix | 9889.4 | |
AtrioventricularNode | 3120.35 | |
BDCA4+_DentriticCells | 13515 | |
Bonemarrow | 5333.85 | |
BronchialEpithelialCells | 12934.45 | |
CD105+_Endothelial | 12841.1 | |
CD14+_Monocytes | 12619.2 | |
CD19+_BCells(neg._sel.) | 14671.05 | |
CD33+_Myeloid | 12847.9 | |
CD34+ | 17499.05 | |
CD4+_Tcells | 17254.85 | |
CD56+_NKCells | 13815.35 | |
CD71+_EarlyErythroid | 8830.55 | |
CD8+_Tcells | 18344.25 | |
CardiacMyocytes | 7710.85 | |
Caudatenucleus | 4648.2 | |
Cerebellum | 2240.95 | |
CerebellumPeduncles | 2727.45 | |
CiliaryGanglion | 2650.7 | |
CingulateCortex | 2699.55 | |
Colorectaladenocarcinoma | 4271.25 | |
DorsalRootGanglion | 3812.55 | |
FetalThyroid | 11337.3 | |
Fetalbrain | 10793.15 | |
Fetalliver | 6884.6 | |
Fetallung | 9789.7 | |
GlobusPallidus | 2076.4 | |
Heart | 1791.45 | |
Hypothalamus | 6667.7 | |
Kidney | 4419.5 | |
Leukemia_chronicMyelogenousK-562 | 9012.35 | |
Leukemia_promyelocytic-HL-60 | 12947.7 | |
Leukemialymphoblastic(MOLT-4) | 12260.15 | |
Liver | 3697.1 | |
Lung | 6922.2 | |
Lymphnode | 11114 | |
Lymphoma_burkitts(Daudi) | 19352.2 | |
Lymphoma_burkitts(Raji) | 13046.15 | |
MedullaOblongata | 3784.3 | |
OccipitalLobe | 4485 | |
OlfactoryBulb | 6708.1 | |
Ovary | 10071.25 | |
Pancreas | 6426.15 | |
PancreaticIslet | 10234.5 | |
ParietalLobe | 2673.85 | |
Pituitary | 12399.6 | |
Placenta | 4702.5 | |
Pons | 3462.45 | |
PrefrontalCortex | 5177.6 | |
Prostate | 8465.05 | |
Salivarygland | 8312.6 | |
SkeletalMuscle | 3303 | |
Skin | 6104.75 | |
SmoothMuscle | 11272.3 | |
Spinalcord | 6054.25 | |
SubthalamicNucleus | 3390.45 | |
SuperiorCervicalGanglion | 2695.65 | |
TemporalLobe | 5063.1 | |
Testis | 3742.1 | |
TestisGermCell | 7267.5 | |
TestisIntersitial | 6561.9 | |
TestisLeydigCell | 6458.15 | |
TestisSeminiferousTubule | 5408.95 | |
Thalamus | 4412.05 | |
Thymus | 8258.05 | |
Thyroid | 11140.6 | |
Tongue | 7831.25 | |
Tonsil | 10089.75 | |
Trachea | 6428 | |
TrigeminalGanglion | 4952.6 | |
Uterus | 10345.85 | |
UterusCorpus | 12525.7 | |
WholeBlood | 11631.4 | |
Wholebrain | 4100.5 | |
colon | 7445.7 | |
pineal_day | 8202.96 | |
pineal_night | 7815.64 | |
retina | 7210.15 | |
small_intestine | 6340 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_24_P383999
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 9.65 ± 0.43 | |
Basal Forebrain | 10.01 ± 0.04 | |
Basal Part of Pons | 9.84 ± 0.52 | |
Cerebellar Cortex | 10.01 ± 0.35 | |
Cerebellar Nuclei | 9.61 ± 0.56 | |
Claustrum | 9.12 ± 0.85 | |
Epithalamus | 10.09 ± 0.27 | |
Frontal Lobe | 9.78 ± 0.47 | |
Globus Pallidus | 10.37 ± 0.21 | |
Hypothalamus | 10.06 ± 0.33 | |
Insula | 9.83 ± 0.42 | |
Limbic Lobe | 9.39 ± 0.51 | |
Mesencephalon | 9.66 ± 0.53 | |
Myelencephalon | 9.66 ± 0.49 | |
Occipital Lobe | 9.04 ± 0.57 | |
Parietal Lobe | 9.62 ± 0.42 | |
Pontine Tegmentum | 9.72 ± 0.41 | |
Striatum | 9.46 ± 0.42 | |
Subthalamus | 9.8 ± 0.23 | |
Temporal Lobe | 9.81 ± 0.39 | |
Thalamus | 9.6 ± 0.46 | |
White Matter | 10.16 ± 0.66 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Rps3a | CB | Cerebellum | 38.24 | |
81.01 | ||||
Rps3a | CTX | Cerebral cortex | 100 | |
100 | ||||
Rps3a | HIP | Hippocampal region | 100 | |
100 | ||||
Rps3a | HPF | Hippocampal formation | 100 | |
100 | ||||
Rps3a | HY | Hypothalamus | 100 | |
100 | ||||
Rps3a | LSX | Lateral septal complex | 100 | |
100 | ||||
Rps3a | MB | Midbrain | 100 | |
100 | ||||
Rps3a | MY | Medulla | 66.32 | |
100 | ||||
Rps3a | OLF | Olfactory bulb | 100 | |
100 | ||||
Rps3a | P | Pons | 81.35 | |
100 | ||||
Rps3a | PAL | Pallidum | 100 | |
100 | ||||
Rps3a | RHP | Retrohippocampal region | 100 | |
100 | ||||
Rps3a | sAMY | Striatum-like amygdalar nuclei | 100 | |
100 | ||||
Rps3a | STR | Striatum | 100 | |
100 | ||||
Rps3a | STRd | Striatum dorsal region | 100 | |
100 | ||||
Rps3a | STRv | Striatum ventral region | 100 | |
100 | ||||
Rps3a | TH | Thalamus | 100 | |
100 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00000233 | 14 | 200 | 213 | ACQSIYPLHDVFVR | Peptide Atlas |
RS3A_HUMAN_1 | 7 | 1 | 7 | AVGKNKR | PRIDE |
RS3A_HUMAN_128 | 8 | 128 | 135 | TTDGYLLR | PRIDE |
RS3A_HUMAN_136 | 8 | 136 | 143 | LFCVGFTK | PRIDE |
RS3A_HUMAN_167 | 7 | 167 | 173 | MMEIMTR | PRIDE |
RS3A_HUMAN_187 | 12 | 187 | 198 | LIPDSIGKDIEK | PRIDE |
RS3A_HUMAN_199 | 14 | 199 | 212 | ACQSIYPLHDVFVR | PRIDE |
RS3A_HUMAN_2 | 7 | 2 | 8 | AVGKNKR | PRIDE |
RS3A_HUMAN_220 | 32 | 220 | 251 | PKFELGKLMELHGEGSSSGKATGDETGAKVER | PRIDE |
RS3A_HUMAN_227 | 13 | 227 | 239 | LMELHGEGSSSGK | PRIDE |
RS3A_HUMAN_227 | 25 | 227 | 251 | LMELHGEGSSSGKATGDETGAKVER | PRIDE |
RS3A_HUMAN_252 | 12 | 252 | 263 | ADGYEPPVQESV | PRIDE |
RS3A_HUMAN_253 | 12 | 253 | 264 | ADGYEPPVQESV | PRIDE |
RS3A_HUMAN_34 | 8 | 34 | 41 | APAMFNIR | PRIDE |
RS3A_HUMAN_42 | 9 | 42 | 50 | NIGKTLVTR | PRIDE |
RS3A_HUMAN_52 | 14 | 52 | 65 | TQGTKIASDGLKGR | PRIDE |
RS3A_HUMAN_65 | 17 | 65 | 81 | VFEVSLADLQNDEVAFR | PRIDE |
RS3A_HUMAN_65 | 18 | 65 | 82 | VFEVSLADLQNDEVAFRK | PRIDE |
RS3A_HUMAN_85 | 9 | 85 | 93 | LITEDVQGK | PRIDE |
RS3A_HUMAN_94 | 13 | 94 | 106 | NCLTNFHGMDLTR | PRIDE |