Annotation Detail for RPS7


Gene Symbol: | RPS7 ( DBA8 ) |
---|---|
Gene Full Name: | ribosomal protein S7 |
Band: | 2p25.3 |
Quick Links | Entrez ID:6201; OMIM: 603658; Uniprot ID:RS7_HUMAN; ENSEMBL ID: ENSG00000171863; HGNC ID: 10440 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.646582
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 15 / 70761 | 211 | ![]() |
blastocyst | 33 / 62319 | 529 | ![]() |
fetus | 96 / 564012 | 170 | ![]() |
neonate | 22 / 31097 | 707 | ![]() |
infant | 4 / 23620 | 169 | ![]() |
juvenile | 3 / 55556 | 53 | ![]() |
adult | 401 / 1939121 | 206 | ![]() |
embryoid body | 21 / 70761 | 296 | ![]() |
blastocyst | 10 / 62319 | 160 | ![]() |
fetus | 109 / 564012 | 193 | ![]() |
neonate | 20 / 31097 | 643 | ![]() |
infant | 3 / 23620 | 127 | ![]() |
juvenile | 37 / 55556 | 665 | ![]() |
adult | 261 / 1939121 | 134 | ![]() |
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 1 / 564012 | 1 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 1 / 55556 | 17 | ![]() |
adult | 9 / 1939121 | 4 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 5 / 12794 | 390 | ![]() |
bladder carcinoma | 1 / 17475 | 57 | ![]() |
breast (mammary gland) tumor | 36 / 94178 | 382 | ![]() |
cervical tumor | 4 / 34366 | 116 | ![]() |
chondrosarcoma | 23 / 82823 | 277 | ![]() |
colorectal tumor | 20 / 114246 | 175 | ![]() |
esophageal tumor | 1 / 17290 | 57 | ![]() |
gastrointestinal tumor | 21 / 119369 | 175 | ![]() |
germ cell tumor | 42 / 263845 | 159 | ![]() |
glioma | 10 / 106883 | 93 | ![]() |
head and neck tumor | 29 / 136302 | 212 | ![]() |
kidney tumor | 22 / 68959 | 319 | ![]() |
leukemia | 9 / 95842 | 93 | ![]() |
liver tumor | 25 / 96359 | 259 | ![]() |
lung tumor | 40 / 103127 | 387 | ![]() |
lymphoma | 29 / 71755 | 404 | ![]() |
non-neoplasia | 8 / 97250 | 82 | ![]() |
normal | 703 / 3360307 | 209 | ![]() |
ovarian tumor | 12 / 76682 | 156 | ![]() |
pancreatic tumor | 27 / 104616 | 258 | ![]() |
primitive neuroectodermal tumor of the CNS | 21 / 125680 | 167 | ![]() |
prostate cancer | 61 / 102680 | 594 | ![]() |
retinoblastoma | 22 / 46356 | 474 | ![]() |
skin tumor | 44 / 124949 | 352 | ![]() |
soft tissue/muscle tissue tumor | 36 / 125191 | 287 | ![]() |
uterine tumor | 11 / 90257 | 121 | ![]() |
adrenal tumor | 3 / 12794 | 234 | ![]() |
bladder carcinoma | 5 / 17475 | 286 | ![]() |
breast (mammary gland) tumor | 10 / 94178 | 106 | ![]() |
cervical tumor | 4 / 34366 | 116 | ![]() |
chondrosarcoma | 2 / 82823 | 24 | ![]() |
colorectal tumor | 37 / 114246 | 323 | ![]() |
esophageal tumor | 1 / 17290 | 57 | ![]() |
gastrointestinal tumor | 49 / 119369 | 410 | ![]() |
germ cell tumor | 29 / 263845 | 109 | ![]() |
glioma | 4 / 106883 | 37 | ![]() |
head and neck tumor | 6 / 136302 | 44 | ![]() |
kidney tumor | 6 / 68959 | 87 | ![]() |
leukemia | 66 / 95842 | 688 | ![]() |
liver tumor | 24 / 96359 | 249 | ![]() |
lung tumor | 21 / 103127 | 203 | ![]() |
lymphoma | 25 / 71755 | 348 | ![]() |
non-neoplasia | 4 / 97250 | 41 | ![]() |
normal | 478 / 3360307 | 142 | ![]() |
ovarian tumor | 12 / 76682 | 156 | ![]() |
pancreatic tumor | 15 / 104616 | 143 | ![]() |
primitive neuroectodermal tumor of the CNS | 23 / 125680 | 183 | ![]() |
prostate cancer | 47 / 102680 | 457 | ![]() |
retinoblastoma | 5 / 46356 | 107 | ![]() |
skin tumor | 23 / 124949 | 184 | ![]() |
soft tissue/muscle tissue tumor | 16 / 125191 | 127 | ![]() |
uterine tumor | 27 / 90257 | 299 | ![]() |
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | ![]() |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 1 / 114246 | 8 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 0 / 263845 | 0 | |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 1 / 136302 | 7 | ![]() |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 0 / 97250 | 0 | |
normal | 6 / 3360307 | 1 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | ![]() |
prostate cancer | 4 / 102680 | 38 | ![]() |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 1 / 125191 | 7 | ![]() |
uterine tumor | 2 / 90257 | 22 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 10 / 33197 | 301 | ![]() |
ascites | 4 / 40015 | 99 | ![]() |
bladder | 6 / 29757 | 201 | ![]() |
blood | 20 / 123478 | 161 | ![]() |
bone | 25 / 71655 | 348 | ![]() |
bone marrow | 8 / 48801 | 163 | ![]() |
brain | 64 / 1100989 | 58 | ![]() |
cervix | 5 / 48171 | 103 | ![]() |
connective tissue | 15 / 149255 | 100 | ![]() |
ear | 3 / 16212 | 185 | ![]() |
embryonic tissue | 139 / 215722 | 644 | ![]() |
esophagus | 1 / 20209 | 49 | ![]() |
eye | 70 / 211054 | 331 | ![]() |
heart | 17 / 89626 | 189 | ![]() |
intestine | 40 / 234472 | 170 | ![]() |
kidney | 28 / 211777 | 132 | ![]() |
larynx | 1 / 24145 | 41 | ![]() |
liver | 41 / 207743 | 197 | ![]() |
lung | 100 / 336974 | 296 | ![]() |
lymph | 19 / 44270 | 429 | ![]() |
lymph node | 9 / 91610 | 98 | ![]() |
mammary gland | 37 / 153271 | 241 | ![]() |
mouth | 3 / 67052 | 44 | ![]() |
muscle | 33 / 107715 | 306 | ![]() |
nerve | 2 / 15768 | 126 | ![]() |
ovary | 20 / 102051 | 195 | ![]() |
pancreas | 130 / 214812 | 605 | ![]() |
parathyroid | 4 / 20539 | 194 | ![]() |
pharynx | 4 / 41328 | 96 | ![]() |
pituitary gland | 6 / 16585 | 361 | ![]() |
placenta | 42 / 280825 | 149 | ![]() |
prostate | 80 / 189345 | 422 | ![]() |
salivary gland | 6 / 20155 | 297 | ![]() |
skin | 56 / 210574 | 265 | ![]() |
spleen | 8 / 53952 | 148 | ![]() |
stomach | 15 / 96619 | 155 | ![]() |
testis | 34 / 330442 | 102 | ![]() |
thymus | 3 / 81131 | 36 | ![]() |
thyroid | 18 / 47473 | 379 | ![]() |
tonsil | 12 / 16999 | 705 | ![]() |
trachea | 0 / 52413 | 0 | |
umbilical cord | 22 / 13680 | 1608 | ![]() |
uterus | 21 / 232878 | 90 | ![]() |
vascular | 18 / 51780 | 347 | ![]() |
adipose tissue | 5 / 13106 | 381 | ![]() |
adrenal gland | 8 / 33197 | 240 | ![]() |
ascites | 27 / 40015 | 674 | ![]() |
bladder | 6 / 29757 | 201 | ![]() |
blood | 47 / 123478 | 380 | ![]() |
bone | 8 / 71655 | 111 | ![]() |
bone marrow | 35 / 48801 | 717 | ![]() |
brain | 79 / 1100989 | 71 | ![]() |
cervix | 4 / 48171 | 83 | ![]() |
connective tissue | 3 / 149255 | 20 | ![]() |
ear | 8 / 16212 | 493 | ![]() |
embryonic tissue | 76 / 215722 | 352 | ![]() |
esophagus | 1 / 20209 | 49 | ![]() |
eye | 37 / 211054 | 175 | ![]() |
heart | 37 / 89626 | 412 | ![]() |
intestine | 45 / 234472 | 191 | ![]() |
kidney | 29 / 211777 | 136 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 39 / 207743 | 187 | ![]() |
lung | 49 / 336974 | 145 | ![]() |
lymph | 6 / 44270 | 135 | ![]() |
lymph node | 32 / 91610 | 349 | ![]() |
mammary gland | 10 / 153271 | 65 | ![]() |
mouth | 3 / 67052 | 44 | ![]() |
muscle | 11 / 107715 | 102 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 18 / 102051 | 176 | ![]() |
pancreas | 36 / 214812 | 167 | ![]() |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 7 / 41328 | 169 | ![]() |
pituitary gland | 3 / 16585 | 180 | ![]() |
placenta | 22 / 280825 | 78 | ![]() |
prostate | 56 / 189345 | 295 | ![]() |
salivary gland | 1 / 20155 | 49 | ![]() |
skin | 34 / 210574 | 161 | ![]() |
spleen | 9 / 53952 | 166 | ![]() |
stomach | 22 / 96619 | 227 | ![]() |
testis | 39 / 330442 | 118 | ![]() |
thymus | 16 / 81131 | 197 | ![]() |
thyroid | 3 / 47473 | 63 | ![]() |
tonsil | 5 / 16999 | 294 | ![]() |
trachea | 2 / 52413 | 38 | ![]() |
umbilical cord | 20 / 13680 | 1461 | ![]() |
uterus | 45 / 232878 | 193 | ![]() |
vascular | 18 / 51780 | 347 | ![]() |
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 0 / 123478 | 0 | |
bone | 2 / 71655 | 27 | ![]() |
bone marrow | 2 / 48801 | 40 | ![]() |
brain | 3 / 1100989 | 2 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 0 / 149255 | 0 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 0 / 20209 | 0 | |
eye | 0 / 211054 | 0 | |
heart | 0 / 89626 | 0 | |
intestine | 1 / 234472 | 4 | ![]() |
kidney | 0 / 211777 | 0 | |
larynx | 0 / 24145 | 0 | |
liver | 0 / 207743 | 0 | |
lung | 0 / 336974 | 0 | |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 1 / 153271 | 6 | ![]() |
mouth | 1 / 67052 | 14 | ![]() |
muscle | 1 / 107715 | 9 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 1 / 214812 | 4 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 0 / 280825 | 0 | |
prostate | 3 / 189345 | 15 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 0 / 210574 | 0 | |
spleen | 0 / 53952 | 0 | |
stomach | 0 / 96619 | 0 | |
testis | 3 / 330442 | 9 | ![]() |
thymus | 0 / 81131 | 0 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 2 / 232878 | 8 | ![]() |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 213941_x_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 7441.35 | ![]() |
Adipocyte | 2606.3 | ![]() |
AdrenalCortex | 2155.6 | ![]() |
Adrenalgland | 1009.35 | ![]() |
Amygdala | 1309.45 | ![]() |
Appendix | 2503.2 | ![]() |
AtrioventricularNode | 657.75 | ![]() |
BDCA4+_DentriticCells | 6900.1 | ![]() |
Bonemarrow | 1586.55 | ![]() |
BronchialEpithelialCells | 6066.7 | ![]() |
CD105+_Endothelial | 6507.45 | ![]() |
CD14+_Monocytes | 5169.05 | ![]() |
CD19+_BCells(neg._sel.) | 8762.5 | ![]() |
CD33+_Myeloid | 6611.85 | ![]() |
CD34+ | 9653.45 | ![]() |
CD4+_Tcells | 6998.7 | ![]() |
CD56+_NKCells | 7263.6 | ![]() |
CD71+_EarlyErythroid | 2834.65 | ![]() |
CD8+_Tcells | 6920.8 | ![]() |
CardiacMyocytes | 2965.4 | ![]() |
Caudatenucleus | 982.75 | ![]() |
Cerebellum | 428.6 | ![]() |
CerebellumPeduncles | 1405.45 | ![]() |
CiliaryGanglion | 580.95 | ![]() |
CingulateCortex | 931 | ![]() |
Colorectaladenocarcinoma | 4846.65 | ![]() |
DorsalRootGanglion | 860.05 | ![]() |
FetalThyroid | 3582.15 | ![]() |
Fetalbrain | 1927.25 | ![]() |
Fetalliver | 1924.1 | ![]() |
Fetallung | 3725.6 | ![]() |
GlobusPallidus | 662.4 | ![]() |
Heart | 175.2 | ![]() |
Hypothalamus | 1806.65 | ![]() |
Kidney | 902.35 | ![]() |
Leukemia_chronicMyelogenousK-562 | 5711.35 | ![]() |
Leukemia_promyelocytic-HL-60 | 7102.9 | ![]() |
Leukemialymphoblastic(MOLT-4) | 4660.05 | ![]() |
Liver | 489.45 | ![]() |
Lung | 2030.6 | ![]() |
Lymphnode | 4291.65 | ![]() |
Lymphoma_burkitts(Daudi) | 9355.85 | ![]() |
Lymphoma_burkitts(Raji) | 9420.15 | ![]() |
MedullaOblongata | 956.35 | ![]() |
OccipitalLobe | 900.15 | ![]() |
OlfactoryBulb | 1988.55 | ![]() |
Ovary | 3380.6 | ![]() |
Pancreas | 3859.15 | ![]() |
PancreaticIslet | 3861.25 | ![]() |
ParietalLobe | 627.7 | ![]() |
Pituitary | 3509.55 | ![]() |
Placenta | 2324.95 | ![]() |
Pons | 690.1 | ![]() |
PrefrontalCortex | 2148.85 | ![]() |
Prostate | 3391.6 | ![]() |
Salivarygland | 3463.6 | ![]() |
SkeletalMuscle | 478.35 | ![]() |
Skin | 2174.1 | ![]() |
SmoothMuscle | 4887.4 | ![]() |
Spinalcord | 1396.95 | ![]() |
SubthalamicNucleus | 811.5 | ![]() |
SuperiorCervicalGanglion | 237.05 | ![]() |
TemporalLobe | 1186.3 | ![]() |
Testis | 1188.3 | ![]() |
TestisGermCell | 2502.45 | ![]() |
TestisIntersitial | 2835.85 | ![]() |
TestisLeydigCell | 1817.2 | ![]() |
TestisSeminiferousTubule | 2118.25 | ![]() |
Thalamus | 1032.8 | ![]() |
Thymus | 2815.75 | ![]() |
Thyroid | 4551.7 | ![]() |
Tongue | 3273.4 | ![]() |
Tonsil | 3928.05 | ![]() |
Trachea | 1502.2 | ![]() |
TrigeminalGanglion | 807.8 | ![]() |
Uterus | 3650.55 | ![]() |
UterusCorpus | 2615.95 | ![]() |
WholeBlood | 4244.15 | ![]() |
Wholebrain | 1128.75 | ![]() |
colon | 2589.4 | ![]() |
pineal_day | 3789.32 | ![]() |
pineal_night | 2915.62 | ![]() |
retina | 1790.475 | ![]() |
small_intestine | 2576.95 | ![]() |
- Probe name: CUST_4096_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 12.61 ± 0.28 | ![]() ![]() ![]() |
Basal Forebrain | 12.66 ± 0.09 | ![]() ![]() ![]() |
Basal Part of Pons | 12.57 ± 0.31 | ![]() ![]() ![]() |
Cerebellar Cortex | 12.66 ± 0.2 | ![]() ![]() ![]() |
Cerebellar Nuclei | 12.55 ± 0.32 | ![]() ![]() ![]() |
Claustrum | 12.11 ± 0.53 | ![]() ![]() ![]() |
Epithalamus | 12.48 ± 0.39 | ![]() ![]() ![]() |
Frontal Lobe | 12.43 ± 0.33 | ![]() ![]() ![]() |
Globus Pallidus | 13.09 ± 0.2 | ![]() ![]() ![]() |
Hypothalamus | 12.51 ± 0.55 | ![]() ![]() ![]() |
Insula | 12.54 ± 0.34 | ![]() ![]() ![]() |
Limbic Lobe | 12.3 ± 0.33 | ![]() ![]() ![]() |
Mesencephalon | 12.49 ± 0.41 | ![]() ![]() ![]() |
Myelencephalon | 12.44 ± 0.35 | ![]() ![]() ![]() |
Occipital Lobe | 12.29 ± 0.29 | ![]() ![]() ![]() |
Parietal Lobe | 12.45 ± 0.35 | ![]() ![]() ![]() |
Pontine Tegmentum | 12.48 ± 0.28 | ![]() ![]() ![]() |
Striatum | 12.53 ± 0.34 | ![]() ![]() ![]() |
Subthalamus | 12.63 ± 0.11 | ![]() ![]() ![]() |
Temporal Lobe | 12.51 ± 0.32 | ![]() ![]() ![]() |
Thalamus | 12.4 ± 0.25 | ![]() ![]() ![]() |
White Matter | 12.8 ± 0.38 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Rps7 | CB | Cerebellum | 29.96 | ![]() |
66.86 | ![]() | |||
Rps7 | CTX | Cerebral cortex | 100 | ![]() |
100 | ![]() | |||
Rps7 | HIP | Hippocampal region | 100 | ![]() |
100 | ![]() | |||
Rps7 | HPF | Hippocampal formation | 100 | ![]() |
100 | ![]() | |||
Rps7 | HY | Hypothalamus | 100 | ![]() |
100 | ![]() | |||
Rps7 | LSX | Lateral septal complex | 94.92 | ![]() |
99.92 | ![]() | |||
Rps7 | MB | Midbrain | 78.39 | ![]() |
100 | ![]() | |||
Rps7 | MY | Medulla | 66.12 | ![]() |
100 | ![]() | |||
Rps7 | OLF | Olfactory bulb | 92.59 | ![]() |
100 | ![]() | |||
Rps7 | P | Pons | 74.14 | ![]() |
100 | ![]() | |||
Rps7 | PAL | Pallidum | 79.12 | ![]() |
100 | ![]() | |||
Rps7 | RHP | Retrohippocampal region | 100 | ![]() |
100 | ![]() | |||
Rps7 | sAMY | Striatum-like amygdalar nuclei | 100 | ![]() |
100 | ![]() | |||
Rps7 | STR | Striatum | 67.61 | ![]() |
72.32 | ![]() | |||
Rps7 | STRd | Striatum dorsal region | 43.11 | ![]() |
43.09 | ![]() | |||
Rps7 | STRv | Striatum ventral region | 96.51 | ![]() |
91.99 | ![]() | |||
Rps7 | TH | Thalamus | 66.07 | ![]() |
82.99 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00004114 | 30 | 8 | 37 | IVKPNGEKPDEFESGISQALLELEMNSDLK | Peptide Atlas |
RS7_HUMAN_0 | 0 | 0 | 0 | AIIIFVPVPQLK | PRIDE |
RS7_HUMAN_1 | 41 | 1 | 41 | MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLR | PRIDE |
RS7_HUMAN_100 | 7 | 100 | 106 | ILPKPTR | PRIDE |
RS7_HUMAN_120 | 22 | 120 | 141 | TLTAVHDAILEDLVFPSEIVGK | PRIDE |
RS7_HUMAN_120 | 23 | 120 | 142 | TLTAVHDAILEDLVFPSEIVGKR | PRIDE |
RS7_HUMAN_121 | 23 | 121 | 143 | TLTAVHDAILEDLVFPSEIVGKR | PRIDE |
RS7_HUMAN_133 | 11 | 133 | 143 | LVFPSEIVGKR | PRIDE |
RS7_HUMAN_155 | 23 | 155 | 177 | VHLDKAQQNNVEHKVETFSGVYK | PRIDE |
RS7_HUMAN_169 | 9 | 169 | 177 | VETFSGVYK | PRIDE |
RS7_HUMAN_170 | 9 | 170 | 178 | VETFSGVYK | PRIDE |
RS7_HUMAN_179 | 15 | 179 | 193 | LTGKDVNFEFPEFQL | PRIDE |
RS7_HUMAN_183 | 11 | 183 | 193 | DVNFEFPEFQL | PRIDE |
RS7_HUMAN_41 | 17 | 41 | 57 | ELNITAAKEIEVGGGRK | PRIDE |
RS7_HUMAN_57 | 13 | 57 | 69 | KAIIIFVPVPQLK | PRIDE |
RS7_HUMAN_58 | 12 | 58 | 69 | AIIIFVPVPQLK | PRIDE |
RS7_HUMAN_7 | 30 | 7 | 36 | IVKPNGEKPDEFESGISQALLELEMNSDLK | PRIDE |
RS7_HUMAN_7 | 34 | 7 | 40 | IVKPNGEKPDEFESGISQALLELEMNSDLKAQLR | PRIDE |