Annotation Detail for UBE2O
Basic Information Top
| Gene Symbol: | UBE2O ( E2-230K,FLJ12878,KIAA1734 ) |
|---|---|
| Gene Full Name: | ubiquitin-conjugating enzyme E2O |
| Band: | 17q25.1 |
| Quick Links | Entrez ID:63893; OMIM: NA; Uniprot ID:UBE2O_HUMAN; ENSEMBL ID: ENSG00000175931; HGNC ID: 29554 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.16130
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
 | |||
| embryoid body | 4 / 70761 | 56 |  |
| blastocyst | 5 / 62319 | 80 | |
| fetus | 32 / 564012 | 56 | |
| neonate | 1 / 31097 | 32 |  |
| infant | 0 / 23620 | 0 | |
| juvenile | 2 / 55556 | 35 | |
| adult | 72 / 1939121 | 37 | |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
| |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 3 / 94178 | 31 | |
| cervical tumor | 1 / 34366 | 29 | |
| chondrosarcoma | 1 / 82823 | 12 | |
| colorectal tumor | 7 / 114246 | 61 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 5 / 119369 | 41 | |
| germ cell tumor | 15 / 263845 | 56 | |
| glioma | 5 / 106883 | 46 | |
| head and neck tumor | 8 / 136302 | 58 | |
| kidney tumor | 5 / 68959 | 72 | |
| leukemia | 2 / 95842 | 20 | |
| liver tumor | 13 / 96359 | 134 | |
| lung tumor | 7 / 103127 | 67 | |
| lymphoma | 2 / 71755 | 27 | |
| non-neoplasia | 5 / 97250 | 51 | |
| normal | 129 / 3360307 | 38 | |
| ovarian tumor | 3 / 76682 | 39 | |
| pancreatic tumor | 10 / 104616 | 95 | |
| primitive neuroectodermal tumor of the CNS | 24 / 125680 | 190 | |
| prostate cancer | 16 / 102680 | 155 | |
| retinoblastoma | 3 / 46356 | 64 | |
| skin tumor | 19 / 124949 | 152 | |
| soft tissue/muscle tissue tumor | 3 / 125191 | 23 | |
| uterine tumor | 4 / 90257 | 44 | |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
| |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 2 / 40015 | 49 | |
| bladder | 0 / 29757 | 0 | |
| blood | 3 / 123478 | 24 | |
| bone | 1 / 71655 | 13 | |
| bone marrow | 0 / 48801 | 0 | |
| brain | 69 / 1100989 | 62 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 2 / 149255 | 13 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 11 / 215722 | 50 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 14 / 211054 | 66 | |
| heart | 3 / 89626 | 33 | |
| intestine | 11 / 234472 | 46 | |
| kidney | 12 / 211777 | 56 | |
| larynx | 2 / 24145 | 82 | |
| liver | 14 / 207743 | 67 | |
| lung | 11 / 336974 | 32 | |
| lymph | 2 / 44270 | 45 | |
| lymph node | 5 / 91610 | 54 | |
| mammary gland | 4 / 153271 | 26 | |
| mouth | 4 / 67052 | 59 | |
| muscle | 4 / 107715 | 37 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 6 / 102051 | 58 | |
| pancreas | 12 / 214812 | 55 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 12 / 280825 | 42 | |
| prostate | 17 / 189345 | 89 | |
| salivary gland | 1 / 20155 | 49 | |
| skin | 21 / 210574 | 99 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 3 / 96619 | 31 | |
| testis | 10 / 330442 | 30 | |
| thymus | 1 / 81131 | 12 | |
| thyroid | 1 / 47473 | 21 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 1 / 13680 | 73 | |
| uterus | 6 / 232878 | 25 | |
| vascular | 1 / 51780 | 19 | |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218141_at
| Cell line | Expression level | Expression bar |
|---|---|---|
| ||
| 721_B_lymphoblasts | 38.05 | |
| Adipocyte | 70.25 | |
| AdrenalCortex | 80.45 | |
| Adrenalgland | 62.3 | |
| Amygdala | 87.6 | |
| Appendix | 76.8 | |
| AtrioventricularNode | 64.25 | |
| BDCA4+_DentriticCells | 34.1 | |
| Bonemarrow | 167.75 | |
| BronchialEpithelialCells | 71.6 | |
| CD105+_Endothelial | 17.45 | |
| CD14+_Monocytes | 28 | |
| CD19+_BCells(neg._sel.) | 75.8 | |
| CD33+_Myeloid | 33.95 | |
| CD34+ | 8.3 |  |
| CD4+_Tcells | 41.9 | |
| CD56+_NKCells | 30.1 | |
| CD71+_EarlyErythroid | 355 |  |
| CD8+_Tcells | 32.3 | |
| CardiacMyocytes | 75.6 | |
| Caudatenucleus | 67.55 | |
| Cerebellum | 77 | |
| CerebellumPeduncles | 91.45 | |
| CiliaryGanglion | 55.25 | |
| CingulateCortex | 78.9 | |
| Colorectaladenocarcinoma | 74.1 | |
| DorsalRootGanglion | 75.85 | |
| FetalThyroid | 82.7 | |
| Fetalbrain | 96.25 | |
| Fetalliver | 116.5 | |
| Fetallung | 59.55 | |
| GlobusPallidus | 45.9 | |
| Heart | 92 | |
| Hypothalamus | 80.05 | |
| Kidney | 66.45 | |
| Leukemia_chronicMyelogenousK-562 | 76.95 | |
| Leukemia_promyelocytic-HL-60 | 64.4 | |
| Leukemialymphoblastic(MOLT-4) | 89 | |
| Liver | 102.3 | |
| Lung | 81.2 | |
| Lymphnode | 68.65 | |
| Lymphoma_burkitts(Daudi) | 96.2 | |
| Lymphoma_burkitts(Raji) | 141.85 | |
| MedullaOblongata | 66.3 | |
| OccipitalLobe | 65.15 | |
| OlfactoryBulb | 59.4 | |
| Ovary | 52.6 | |
| Pancreas | 63.3 | |
| PancreaticIslet | 72.05 | |
| ParietalLobe | 89.45 | |
| Pituitary | 84.95 | |
| Placenta | 73.5 | |
| Pons | 68.85 | |
| PrefrontalCortex | 128.1 | |
| Prostate | 84.85 | |
| Salivarygland | 58.75 | |
| SkeletalMuscle | 88.25 | |
| Skin | 55.5 | |
| SmoothMuscle | 63.55 | |
| Spinalcord | 76.1 | |
| SubthalamicNucleus | 62.8 | |
| SuperiorCervicalGanglion | 86 | |
| TemporalLobe | 67.2 | |
| Testis | 91.6 | |
| TestisGermCell | 58.45 | |
| TestisIntersitial | 60.15 | |
| TestisLeydigCell | 78 | |
| TestisSeminiferousTubule | 118.35 | |
| Thalamus | 74.5 | |
| Thymus | 62.35 | |
| Thyroid | 96.35 | |
| Tongue | 75.25 | |
| Tonsil | 73.1 | |
| Trachea | 60.95 | |
| TrigeminalGanglion | 73.5 | |
| Uterus | 60.7 | |
| UterusCorpus | 67.7 | |
| WholeBlood | 75.5 | |
| Wholebrain | 82.35 | |
| colon | 57.8 | |
| pineal_day | 70.58 | |
| pineal_night | 51.7 | |
| retina | 70.9 | |
| small_intestine | 35.9 | |
- Probe name: CUST_8017_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 4.87 ± 0.58 | ![](../"images/bar_3.png"){kind=small}   |
| Basal Forebrain | 4.58 ± 0.37 | |
| Basal Part of Pons | 5.22 ± 0.41 | |
| Cerebellar Cortex | 5.2 ± 0.38 | |
| Cerebellar Nuclei | 4.82 ± 0.52 | |
| Claustrum | 5.03 ± 0.63 | |
| Epithalamus | 4.07 ± 0.69 | |
| Frontal Lobe | 4.72 ± 0.49 | |
| Globus Pallidus | 4.03 ± 0.64 | |
| Hypothalamus | 4.07 ± 0.39 | |
| Insula | 4.84 ± 0.48 | |
| Limbic Lobe | 4.93 ± 0.55 | |
| Mesencephalon | 4.69 ± 0.47 | |
| Myelencephalon | 4.73 ± 0.45 | |
| Occipital Lobe | 5.22 ± 0.46 | |
| Parietal Lobe | 4.88 ± 0.41 | |
| Pontine Tegmentum | 4.66 ± 0.54 | |
| Striatum | 4.45 ± 0.54 | |
| Subthalamus | 4.05 ± 0.68 | |
| Temporal Lobe | 4.77 ± 0.49 | |
| Thalamus | 4.77 ± 0.44 | |
| White Matter | 4.15 ± 0.38 | |
Mouse Brain ISH 
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Ube2o | CB | Cerebellum | 37.1 | |
| 47.17 | | |||
| Ube2o | CTX | Cerebral cortex | 100 | |
| 100 | | |||
| Ube2o | HIP | Hippocampal region | 53.1 | |
| 87.05 | | |||
| Ube2o | HPF | Hippocampal formation | 55.1 | |
| 72.61 | | |||
| Ube2o | HY | Hypothalamus | 79.88 | |
| 70.34 | | |||
| Ube2o | LSX | Lateral septal complex | 80.07 | |
| 60.68 | | |||
| Ube2o | MB | Midbrain | 60.43 | |
| 59.38 | | |||
| Ube2o | MY | Medulla | 69.58 | |
| 83.96 | | |||
| Ube2o | OLF | Olfactory bulb | 100 | |
| 96.53 | | |||
| Ube2o | P | Pons | 54.82 | |
| 63.96 | | |||
| Ube2o | PAL | Pallidum | 75.52 | |
| 75.61 | | |||
| Ube2o | RHP | Retrohippocampal region | 59.64 | |
| 50.44 | | |||
| Ube2o | sAMY | Striatum-like amygdalar nuclei | 98.66 | |
| 77.26 | | |||
| Ube2o | STR | Striatum | 64.68 | |
| 48.79 | | |||
| Ube2o | STRd | Striatum dorsal region | 54.52 | |
| 40.74 | | |||
| Ube2o | STRv | Striatum ventral region | 78.09 | |
| 57.26 | | |||
| Ube2o | TH | Thalamus | 86.45 | |
| 83.87 | |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00005473 | 32 | 240 | 271 | LYDVCPHVSDSGLFFDDSYGFYPGQVLIGPAK | Peptide Atlas |
| UBE2O_HUMAN_1248 | 15 | 1248 | 1262 | SGYPDIGFPLFPLSK | PRIDE |
| UBE2O_HUMAN_661 | 22 | 661 | 682 | IGNTEDGAPHKEDEPSVGQVAR | PRIDE |