Annotation Detail for EPS8L2
Basic Information Top
| Gene Symbol: | EPS8L2 ( EPS8R2,FLJ16738,FLJ21935,FLJ22171,MGC126530,MGC3088 ) |
|---|---|
| Gene Full Name: | EPS8-like 2 |
| Band: | 11p15.5 |
| Quick Links | Entrez ID:64787; OMIM: NA; Uniprot ID:ES8L2_HUMAN; ENSEMBL ID: ENSG00000177106; HGNC ID: 21296 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.55016
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 7 / 70761 | 98 | |
| blastocyst | 2 / 62319 | 32 | |
| fetus | 13 / 564012 | 23 | |
| neonate | 1 / 31097 | 32 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 106 / 1939121 | 54 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 5 / 94178 | 53 | |
| cervical tumor | 1 / 34366 | 29 | |
| chondrosarcoma | 8 / 82823 | 96 | |
| colorectal tumor | 16 / 114246 | 140 | |
| esophageal tumor | 7 / 17290 | 404 | |
| gastrointestinal tumor | 5 / 119369 | 41 | |
| germ cell tumor | 8 / 263845 | 30 | |
| glioma | 7 / 106883 | 65 | |
| head and neck tumor | 12 / 136302 | 88 | |
| kidney tumor | 14 / 68959 | 203 | |
| leukemia | 1 / 95842 | 10 | |
| liver tumor | 8 / 96359 | 83 | |
| lung tumor | 8 / 103127 | 77 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 6 / 97250 | 61 | |
| normal | 192 / 3360307 | 57 | |
| ovarian tumor | 4 / 76682 | 52 | |
| pancreatic tumor | 10 / 104616 | 95 | |
| primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
| prostate cancer | 10 / 102680 | 97 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 1 / 124949 | 8 | |
| soft tissue/muscle tissue tumor | 2 / 125191 | 15 | |
| uterine tumor | 1 / 90257 | 11 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 3 / 40015 | 74 | |
| bladder | 2 / 29757 | 67 | |
| blood | 0 / 123478 | 0 | |
| bone | 3 / 71655 | 41 | |
| bone marrow | 0 / 48801 | 0 | |
| brain | 48 / 1100989 | 43 | |
| cervix | 3 / 48171 | 62 | |
| connective tissue | 4 / 149255 | 26 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 10 / 215722 | 46 | |
| esophagus | 7 / 20209 | 346 | |
| eye | 18 / 211054 | 85 | |
| heart | 2 / 89626 | 22 | |
| intestine | 25 / 234472 | 106 | |
| kidney | 37 / 211777 | 174 | |
| larynx | 1 / 24145 | 41 | |
| liver | 10 / 207743 | 48 | |
| lung | 40 / 336974 | 118 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 7 / 153271 | 45 | |
| mouth | 11 / 67052 | 164 | |
| muscle | 2 / 107715 | 18 | |
| nerve | 2 / 15768 | 126 | |
| ovary | 5 / 102051 | 48 | |
| pancreas | 26 / 214812 | 121 | |
| parathyroid | 2 / 20539 | 97 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 31 / 280825 | 110 | |
| prostate | 14 / 189345 | 73 | |
| salivary gland | 3 / 20155 | 148 | |
| skin | 8 / 210574 | 37 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 2 / 96619 | 20 | |
| testis | 4 / 330442 | 12 | |
| thymus | 1 / 81131 | 12 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 10 / 52413 | 190 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 4 / 232878 | 17 | |
| vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218180_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 4.3 | |
| Adipocyte | 3.4 | |
| AdrenalCortex | 3.7 | |
| Adrenalgland | 2.9 | |
| Amygdala | 3.6 | |
| Appendix | 3.45 | |
| AtrioventricularNode | 2.75 | |
| BDCA4+_DentriticCells | 25.9 | |
| Bonemarrow | 3.4 | |
| BronchialEpithelialCells | 59.8 | |
| CD105+_Endothelial | 3.5 | |
| CD14+_Monocytes | 3.7 | |
| CD19+_BCells(neg._sel.) | 3.7 | |
| CD33+_Myeloid | 4.4 | |
| CD34+ | 4.35 | |
| CD4+_Tcells | 3.8 | |
| CD56+_NKCells | 4.15 | |
| CD71+_EarlyErythroid | 3.2 | |
| CD8+_Tcells | 3.35 | |
| CardiacMyocytes | 4.3 | |
| Caudatenucleus | 3.05 | |
| Cerebellum | 6 | |
| CerebellumPeduncles | 4.3 | |
| CiliaryGanglion | 2.35 | |
| CingulateCortex | 3.5 | |
| Colorectaladenocarcinoma | 63 | |
| DorsalRootGanglion | 2.6 | |
| FetalThyroid | 8.25 | |
| Fetalbrain | 3.4 | |
| Fetalliver | 3.2 | |
| Fetallung | 7.6 | |
| GlobusPallidus | 2.5 | |
| Heart | 4.25 | |
| Hypothalamus | 4.5 | |
| Kidney | 53.85 | |
| Leukemia_chronicMyelogenousK-562 | 3.1 | |
| Leukemia_promyelocytic-HL-60 | 3 | |
| Leukemialymphoblastic(MOLT-4) | 2.8 | |
| Liver | 12.15 | |
| Lung | 56 | |
| Lymphnode | 2.95 | |
| Lymphoma_burkitts(Daudi) | 4.35 | |
| Lymphoma_burkitts(Raji) | 4.8 | |
| MedullaOblongata | 3.15 | |
| OccipitalLobe | 3.1 | |
| OlfactoryBulb | 2.7 | |
| Ovary | 2.25 | |
| Pancreas | 8.5 | |
| PancreaticIslet | 4.4 | |
| ParietalLobe | 3.6 | |
| Pituitary | 4.05 | |
| Placenta | 34.7 | |
| Pons | 3.25 | |
| PrefrontalCortex | 4.35 | |
| Prostate | 12.4 | |
| Salivarygland | 3.55 | |
| SkeletalMuscle | 3.85 | |
| Skin | 2.75 | |
| SmoothMuscle | 3.9 | |
| Spinalcord | 3.65 | |
| SubthalamicNucleus | 3.15 | |
| SuperiorCervicalGanglion | 3.85 | |
| TemporalLobe | 3.15 | |
| Testis | 2.95 | |
| TestisGermCell | 2.9 | |
| TestisIntersitial | 2.9 | |
| TestisLeydigCell | 3.35 | |
| TestisSeminiferousTubule | 2.95 | |
| Thalamus | 3.45 | |
| Thymus | 2.7 | |
| Thyroid | 18.6 | |
| Tongue | 14.35 | |
| Tonsil | 4.25 | |
| Trachea | 3.1 | |
| TrigeminalGanglion | 3.4 | |
| Uterus | 2.85 | |
| UterusCorpus | 3.05 | |
| WholeBlood | 3.75 | |
| Wholebrain | 2.95 | |
| colon | 4.55 | |
| pineal_day | 4.5 | |
| pineal_night | 4.26 | |
| retina | 4.15 | |
| small_intestine | 8.6 |
- Probe name: CUST_8587_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 4.05 ± 0.91 | |
| Basal Forebrain | 4.62 ± 0.57 | |
| Basal Part of Pons | 5.19 ± 0.49 | |
| Cerebellar Cortex | 5.32 ± 0.38 | |
| Cerebellar Nuclei | 5.01 ± 0.42 | |
| Claustrum | 5.22 ± 1.05 | |
| Epithalamus | 4.75 ± 0.23 | |
| Frontal Lobe | 4.25 ± 0.74 | |
| Globus Pallidus | 5.14 ± 0.88 | |
| Hypothalamus | 5.05 ± 0.48 | |
| Insula | 3.88 ± 0.53 | |
| Limbic Lobe | 4.22 ± 1.01 | |
| Mesencephalon | 4.77 ± 0.8 | |
| Myelencephalon | 4.55 ± 0.69 | |
| Occipital Lobe | 4.36 ± 0.82 | |
| Parietal Lobe | 4.47 ± 0.87 | |
| Pontine Tegmentum | 4.33 ± 0.88 | |
| Striatum | 4.15 ± 0.97 | |
| Subthalamus | 4.73 ± 0.16 | |
| Temporal Lobe | 4.3 ± 0.68 | |
| Thalamus | 4.86 ± 0.68 | |
| White Matter | 4.11 ± 0.78 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Eps8l2 | CB | Cerebellum | 8.18 | |
| 11.27 | ||||
| Eps8l2 | CTX | Cerebral cortex | 25.47 | |
| 19.85 | ||||
| Eps8l2 | HIP | Hippocampal region | 18.47 | |
| 20.64 | ||||
| Eps8l2 | HPF | Hippocampal formation | 18.62 | |
| 18.84 | ||||
| Eps8l2 | HY | Hypothalamus | 14 | |
| 11.95 | ||||
| Eps8l2 | LSX | Lateral septal complex | 26.34 | |
| 20.61 | ||||
| Eps8l2 | MB | Midbrain | 4.44 | |
| 5.48 | ||||
| Eps8l2 | MY | Medulla | 5.89 | |
| 10.2 | ||||
| Eps8l2 | OLF | Olfactory bulb | 23.95 | |
| 20.97 | ||||
| Eps8l2 | P | Pons | 5.22 | |
| 6.77 | ||||
| Eps8l2 | PAL | Pallidum | 13.75 | |
| 11.71 | ||||
| Eps8l2 | RHP | Retrohippocampal region | 19.76 | |
| 17.04 | ||||
| Eps8l2 | sAMY | Striatum-like amygdalar nuclei | 17.8 | |
| 13.83 | ||||
| Eps8l2 | STR | Striatum | 14.73 | |
| 10.96 | ||||
| Eps8l2 | STRd | Striatum dorsal region | 12.78 | |
| 9.39 | ||||
| Eps8l2 | STRv | Striatum ventral region | 16.68 | |
| 11.79 | ||||
| Eps8l2 | TH | Thalamus | 28.99 | |
| 30.32 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| ES8L2_HUMAN_103 | 20 | 103 | 122 | LLDIESQEELEDFPLPTVQR | PRIDE |
| ES8L2_HUMAN_296 | 10 | 296 | 305 | APAEGVLTLR | PRIDE |
| ES8L2_HUMAN_333 | 32 | 333 | 364 | HIQNPSAAELVHFLFGPLDLIVNTCSGPDIAR | PRIDE |
| ES8L2_HUMAN_366 | 9 | 366 | 374 | SVSCPLLSR | PRIDE |
| ES8L2_HUMAN_375 | 7 | 375 | 381 | DAVDFLR | PRIDE |
| ES8L2_HUMAN_409 | 10 | 409 | 418 | EPQVPLYVPK | PRIDE |
| ES8L2_HUMAN_486 | 10 | 486 | 495 | GYQPTPAMAK | PRIDE |
| ES8L2_HUMAN_516 | 11 | 516 | 526 | DEVLEVLEDGR | PRIDE |
| ES8L2_HUMAN_575 | 9 | 575 | 583 | LPPSFPGNK | PRIDE |
| ES8L2_HUMAN_669 | 8 | 669 | 676 | VCGEEGVR | PRIDE |
| ES8L2_HUMAN_691 | 13 | 691 | 703 | QQSGSELEELMNK | PRIDE |
| ES8L2_HUMAN_87 | 16 | 87 | 102 | IWTQEMLLQVNDQSLR | PRIDE |
| PAp00027728 | 30 | 535 | 564 | SGQAGYVPCNILGEARPEDAGAPFEQAGQK | Peptide Atlas |



