Annotation Detail for SLC30A5
Basic Information Top
| Gene Symbol: | SLC30A5 ( FLJ12496,FLJ12756,MGC5499,ZNT5,ZNTL1,ZTL1,ZnT-5 ) |
|---|---|
| Gene Full Name: | solute carrier family 30 (zinc transporter), member 5 |
| Band: | 5q13.1-q13.2 |
| Quick Links | Entrez ID:64924; OMIM: 607819; Uniprot ID:ZNT5_HUMAN; ENSEMBL ID: ENSG00000145740; HGNC ID: 19089 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.631975
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 5 / 70761 | 70 | |
| blastocyst | 2 / 62319 | 32 | |
| fetus | 14 / 564012 | 24 | |
| neonate | 2 / 31097 | 64 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 3 / 55556 | 53 | |
| adult | 79 / 1939121 | 40 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 2 / 12794 | 156 | |
| bladder carcinoma | 1 / 17475 | 57 | |
| breast (mammary gland) tumor | 2 / 94178 | 21 | |
| cervical tumor | 1 / 34366 | 29 | |
| chondrosarcoma | 3 / 82823 | 36 | |
| colorectal tumor | 3 / 114246 | 26 | |
| esophageal tumor | 1 / 17290 | 57 | |
| gastrointestinal tumor | 1 / 119369 | 8 | |
| germ cell tumor | 18 / 263845 | 68 | |
| glioma | 2 / 106883 | 18 | |
| head and neck tumor | 3 / 136302 | 22 | |
| kidney tumor | 3 / 68959 | 43 | |
| leukemia | 6 / 95842 | 62 | |
| liver tumor | 9 / 96359 | 93 | |
| lung tumor | 2 / 103127 | 19 | |
| lymphoma | 2 / 71755 | 27 | |
| non-neoplasia | 2 / 97250 | 20 | |
| normal | 111 / 3360307 | 33 | |
| ovarian tumor | 1 / 76682 | 13 | |
| pancreatic tumor | 1 / 104616 | 9 | |
| primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | |
| prostate cancer | 7 / 102680 | 68 | |
| retinoblastoma | 2 / 46356 | 43 | |
| skin tumor | 7 / 124949 | 56 | |
| soft tissue/muscle tissue tumor | 1 / 125191 | 7 | |
| uterine tumor | 3 / 90257 | 33 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 2 / 33197 | 60 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 2 / 29757 | 67 | |
| blood | 6 / 123478 | 48 | |
| bone | 4 / 71655 | 55 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 24 / 1100989 | 21 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 0 / 149255 | 0 | |
| ear | 1 / 16212 | 61 | |
| embryonic tissue | 8 / 215722 | 37 | |
| esophagus | 1 / 20209 | 49 | |
| eye | 8 / 211054 | 37 | |
| heart | 0 / 89626 | 0 | |
| intestine | 5 / 234472 | 21 | |
| kidney | 13 / 211777 | 61 | |
| larynx | 0 / 24145 | 0 | |
| liver | 11 / 207743 | 52 | |
| lung | 5 / 336974 | 14 | |
| lymph | 2 / 44270 | 45 | |
| lymph node | 5 / 91610 | 54 | |
| mammary gland | 5 / 153271 | 32 | |
| mouth | 3 / 67052 | 44 | |
| muscle | 3 / 107715 | 27 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 1 / 102051 | 9 | |
| pancreas | 12 / 214812 | 55 | |
| parathyroid | 1 / 20539 | 48 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 16 / 280825 | 56 | |
| prostate | 9 / 189345 | 47 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 9 / 210574 | 42 | |
| spleen | 1 / 53952 | 18 | |
| stomach | 1 / 96619 | 10 | |
| testis | 12 / 330442 | 36 | |
| thymus | 3 / 81131 | 36 | |
| thyroid | 1 / 47473 | 21 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 3 / 52413 | 57 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 9 / 232878 | 38 | |
| vascular | 7 / 51780 | 135 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218989_x_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 43.55 | |
| Adipocyte | 18.2 | |
| AdrenalCortex | 11.2 | |
| Adrenalgland | 8.9 | |
| Amygdala | 10.65 | |
| Appendix | 11.15 | |
| AtrioventricularNode | 9.95 | |
| BDCA4+_DentriticCells | 139.1 | |
| Bonemarrow | 8.7 | |
| BronchialEpithelialCells | 22.1 | |
| CD105+_Endothelial | 12.1 | |
| CD14+_Monocytes | 11.75 | |
| CD19+_BCells(neg._sel.) | 15.35 | |
| CD33+_Myeloid | 21.45 | |
| CD34+ | 35.15 | |
| CD4+_Tcells | 23.6 | |
| CD56+_NKCells | 41.9 | |
| CD71+_EarlyErythroid | 9.85 | |
| CD8+_Tcells | 19.6 | |
| CardiacMyocytes | 17.95 | |
| Caudatenucleus | 7.45 | |
| Cerebellum | 7.45 | |
| CerebellumPeduncles | 11.95 | |
| CiliaryGanglion | 8.5 | |
| CingulateCortex | 9.6 | |
| Colorectaladenocarcinoma | 16.15 | |
| DorsalRootGanglion | 8.05 | |
| FetalThyroid | 9.9 | |
| Fetalbrain | 7.45 | |
| Fetalliver | 13.35 | |
| Fetallung | 12.3 | |
| GlobusPallidus | 7.25 | |
| Heart | 12.8 | |
| Hypothalamus | 11.1 | |
| Kidney | 8.7 | |
| Leukemia_chronicMyelogenousK-562 | 22.1 | |
| Leukemia_promyelocytic-HL-60 | 9.65 | |
| Leukemialymphoblastic(MOLT-4) | 11 | |
| Liver | 12.6 | |
| Lung | 8.75 | |
| Lymphnode | 10.1 | |
| Lymphoma_burkitts(Daudi) | 12.45 | |
| Lymphoma_burkitts(Raji) | 15.9 | |
| MedullaOblongata | 8.95 | |
| OccipitalLobe | 9.45 | |
| OlfactoryBulb | 7.85 | |
| Ovary | 7.35 | |
| Pancreas | 7.85 | |
| PancreaticIslet | 24.5 | |
| ParietalLobe | 11.2 | |
| Pituitary | 17.3 | |
| Placenta | 15.8 | |
| Pons | 9.05 | |
| PrefrontalCortex | 11.55 | |
| Prostate | 11.65 | |
| Salivarygland | 9.05 | |
| SkeletalMuscle | 14.85 | |
| Skin | 8.8 | |
| SmoothMuscle | 16.2 | |
| Spinalcord | 10.15 | |
| SubthalamicNucleus | 9.5 | |
| SuperiorCervicalGanglion | 13.5 | |
| TemporalLobe | 9.35 | |
| Testis | 7.7 | |
| TestisGermCell | 13.25 | |
| TestisIntersitial | 7.05 | |
| TestisLeydigCell | 10.15 | |
| TestisSeminiferousTubule | 8.65 | |
| Thalamus | 10.6 | |
| Thymus | 7.1 | |
| Thyroid | 40.3 | |
| Tongue | 10.9 | |
| Tonsil | 9.2 | |
| Trachea | 9.95 | |
| TrigeminalGanglion | 11.95 | |
| Uterus | 25.1 | |
| UterusCorpus | 11.1 | |
| WholeBlood | 11.8 | |
| Wholebrain | 7.6 | |
| colon | 35.25 | |
| pineal_day | 29.9 | |
| pineal_night | 47.58 | |
| retina | 13.65 | |
| small_intestine | 24.05 |
- Probe name: CUST_6827_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 7.06 ± 0.42 | |
| Basal Forebrain | 7.21 ± 0.24 | |
| Basal Part of Pons | 7.07 ± 0.39 | |
| Cerebellar Cortex | 7.04 ± 0.41 | |
| Cerebellar Nuclei | 7.49 ± 0.36 | |
| Claustrum | 7.42 ± 0.51 | |
| Epithalamus | 7.41 ± 0.28 | |
| Frontal Lobe | 7.13 ± 0.39 | |
| Globus Pallidus | 7.58 ± 0.2 | |
| Hypothalamus | 7.34 ± 0.32 | |
| Insula | 7.11 ± 0.35 | |
| Limbic Lobe | 7.25 ± 0.37 | |
| Mesencephalon | 7.4 ± 0.39 | |
| Myelencephalon | 7.2 ± 0.33 | |
| Occipital Lobe | 7.55 ± 0.35 | |
| Parietal Lobe | 7.3 ± 0.37 | |
| Pontine Tegmentum | 7.24 ± 0.38 | |
| Striatum | 7.21 ± 0.48 | |
| Subthalamus | 7.46 ± 0.13 | |
| Temporal Lobe | 7.08 ± 0.34 | |
| Thalamus | 7.25 ± 0.3 | |
| White Matter | 7.45 ± 0.37 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00040605 | 30 | 372 | 401 | GTLIGYSPEGTPLYNFMGDAFQHSSQSIPR | Peptide Atlas |




Mouse Brain ISH