Annotation Detail for SLC30A5
Basic Information Top
Gene Symbol: | SLC30A5 ( FLJ12496,FLJ12756,MGC5499,ZNT5,ZNTL1,ZTL1,ZnT-5 ) |
---|---|
Gene Full Name: | solute carrier family 30 (zinc transporter), member 5 |
Band: | 5q13.1-q13.2 |
Quick Links | Entrez ID:64924; OMIM: 607819; Uniprot ID:ZNT5_HUMAN; ENSEMBL ID: ENSG00000145740; HGNC ID: 19089 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.631975
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 5 / 70761 | 70 | |
blastocyst | 2 / 62319 | 32 | |
fetus | 14 / 564012 | 24 | |
neonate | 2 / 31097 | 64 | |
infant | 0 / 23620 | 0 | |
juvenile | 3 / 55556 | 53 | |
adult | 79 / 1939121 | 40 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 2 / 12794 | 156 | |
bladder carcinoma | 1 / 17475 | 57 | |
breast (mammary gland) tumor | 2 / 94178 | 21 | |
cervical tumor | 1 / 34366 | 29 | |
chondrosarcoma | 3 / 82823 | 36 | |
colorectal tumor | 3 / 114246 | 26 | |
esophageal tumor | 1 / 17290 | 57 | |
gastrointestinal tumor | 1 / 119369 | 8 | |
germ cell tumor | 18 / 263845 | 68 | |
glioma | 2 / 106883 | 18 | |
head and neck tumor | 3 / 136302 | 22 | |
kidney tumor | 3 / 68959 | 43 | |
leukemia | 6 / 95842 | 62 | |
liver tumor | 9 / 96359 | 93 | |
lung tumor | 2 / 103127 | 19 | |
lymphoma | 2 / 71755 | 27 | |
non-neoplasia | 2 / 97250 | 20 | |
normal | 111 / 3360307 | 33 | |
ovarian tumor | 1 / 76682 | 13 | |
pancreatic tumor | 1 / 104616 | 9 | |
primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | |
prostate cancer | 7 / 102680 | 68 | |
retinoblastoma | 2 / 46356 | 43 | |
skin tumor | 7 / 124949 | 56 | |
soft tissue/muscle tissue tumor | 1 / 125191 | 7 | |
uterine tumor | 3 / 90257 | 33 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 2 / 33197 | 60 | |
ascites | 0 / 40015 | 0 | |
bladder | 2 / 29757 | 67 | |
blood | 6 / 123478 | 48 | |
bone | 4 / 71655 | 55 | |
bone marrow | 1 / 48801 | 20 | |
brain | 24 / 1100989 | 21 | |
cervix | 1 / 48171 | 20 | |
connective tissue | 0 / 149255 | 0 | |
ear | 1 / 16212 | 61 | |
embryonic tissue | 8 / 215722 | 37 | |
esophagus | 1 / 20209 | 49 | |
eye | 8 / 211054 | 37 | |
heart | 0 / 89626 | 0 | |
intestine | 5 / 234472 | 21 | |
kidney | 13 / 211777 | 61 | |
larynx | 0 / 24145 | 0 | |
liver | 11 / 207743 | 52 | |
lung | 5 / 336974 | 14 | |
lymph | 2 / 44270 | 45 | |
lymph node | 5 / 91610 | 54 | |
mammary gland | 5 / 153271 | 32 | |
mouth | 3 / 67052 | 44 | |
muscle | 3 / 107715 | 27 | |
nerve | 0 / 15768 | 0 | |
ovary | 1 / 102051 | 9 | |
pancreas | 12 / 214812 | 55 | |
parathyroid | 1 / 20539 | 48 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 1 / 16585 | 60 | |
placenta | 16 / 280825 | 56 | |
prostate | 9 / 189345 | 47 | |
salivary gland | 0 / 20155 | 0 | |
skin | 9 / 210574 | 42 | |
spleen | 1 / 53952 | 18 | |
stomach | 1 / 96619 | 10 | |
testis | 12 / 330442 | 36 | |
thymus | 3 / 81131 | 36 | |
thyroid | 1 / 47473 | 21 | |
tonsil | 0 / 16999 | 0 | |
trachea | 3 / 52413 | 57 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 9 / 232878 | 38 | |
vascular | 7 / 51780 | 135 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218989_x_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 43.55 | |
Adipocyte | 18.2 | |
AdrenalCortex | 11.2 | |
Adrenalgland | 8.9 | |
Amygdala | 10.65 | |
Appendix | 11.15 | |
AtrioventricularNode | 9.95 | |
BDCA4+_DentriticCells | 139.1 | |
Bonemarrow | 8.7 | |
BronchialEpithelialCells | 22.1 | |
CD105+_Endothelial | 12.1 | |
CD14+_Monocytes | 11.75 | |
CD19+_BCells(neg._sel.) | 15.35 | |
CD33+_Myeloid | 21.45 | |
CD34+ | 35.15 | |
CD4+_Tcells | 23.6 | |
CD56+_NKCells | 41.9 | |
CD71+_EarlyErythroid | 9.85 | |
CD8+_Tcells | 19.6 | |
CardiacMyocytes | 17.95 | |
Caudatenucleus | 7.45 | |
Cerebellum | 7.45 | |
CerebellumPeduncles | 11.95 | |
CiliaryGanglion | 8.5 | |
CingulateCortex | 9.6 | |
Colorectaladenocarcinoma | 16.15 | |
DorsalRootGanglion | 8.05 | |
FetalThyroid | 9.9 | |
Fetalbrain | 7.45 | |
Fetalliver | 13.35 | |
Fetallung | 12.3 | |
GlobusPallidus | 7.25 | |
Heart | 12.8 | |
Hypothalamus | 11.1 | |
Kidney | 8.7 | |
Leukemia_chronicMyelogenousK-562 | 22.1 | |
Leukemia_promyelocytic-HL-60 | 9.65 | |
Leukemialymphoblastic(MOLT-4) | 11 | |
Liver | 12.6 | |
Lung | 8.75 | |
Lymphnode | 10.1 | |
Lymphoma_burkitts(Daudi) | 12.45 | |
Lymphoma_burkitts(Raji) | 15.9 | |
MedullaOblongata | 8.95 | |
OccipitalLobe | 9.45 | |
OlfactoryBulb | 7.85 | |
Ovary | 7.35 | |
Pancreas | 7.85 | |
PancreaticIslet | 24.5 | |
ParietalLobe | 11.2 | |
Pituitary | 17.3 | |
Placenta | 15.8 | |
Pons | 9.05 | |
PrefrontalCortex | 11.55 | |
Prostate | 11.65 | |
Salivarygland | 9.05 | |
SkeletalMuscle | 14.85 | |
Skin | 8.8 | |
SmoothMuscle | 16.2 | |
Spinalcord | 10.15 | |
SubthalamicNucleus | 9.5 | |
SuperiorCervicalGanglion | 13.5 | |
TemporalLobe | 9.35 | |
Testis | 7.7 | |
TestisGermCell | 13.25 | |
TestisIntersitial | 7.05 | |
TestisLeydigCell | 10.15 | |
TestisSeminiferousTubule | 8.65 | |
Thalamus | 10.6 | |
Thymus | 7.1 | |
Thyroid | 40.3 | |
Tongue | 10.9 | |
Tonsil | 9.2 | |
Trachea | 9.95 | |
TrigeminalGanglion | 11.95 | |
Uterus | 25.1 | |
UterusCorpus | 11.1 | |
WholeBlood | 11.8 | |
Wholebrain | 7.6 | |
colon | 35.25 | |
pineal_day | 29.9 | |
pineal_night | 47.58 | |
retina | 13.65 | |
small_intestine | 24.05 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: CUST_6827_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 7.06 ± 0.42 | |
Basal Forebrain | 7.21 ± 0.24 | |
Basal Part of Pons | 7.07 ± 0.39 | |
Cerebellar Cortex | 7.04 ± 0.41 | |
Cerebellar Nuclei | 7.49 ± 0.36 | |
Claustrum | 7.42 ± 0.51 | |
Epithalamus | 7.41 ± 0.28 | |
Frontal Lobe | 7.13 ± 0.39 | |
Globus Pallidus | 7.58 ± 0.2 | |
Hypothalamus | 7.34 ± 0.32 | |
Insula | 7.11 ± 0.35 | |
Limbic Lobe | 7.25 ± 0.37 | |
Mesencephalon | 7.4 ± 0.39 | |
Myelencephalon | 7.2 ± 0.33 | |
Occipital Lobe | 7.55 ± 0.35 | |
Parietal Lobe | 7.3 ± 0.37 | |
Pontine Tegmentum | 7.24 ± 0.38 | |
Striatum | 7.21 ± 0.48 | |
Subthalamus | 7.46 ± 0.13 | |
Temporal Lobe | 7.08 ± 0.34 | |
Thalamus | 7.25 ± 0.3 | |
White Matter | 7.45 ± 0.37 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00040605 | 30 | 372 | 401 | GTLIGYSPEGTPLYNFMGDAFQHSSQSIPR | Peptide Atlas |