AutismKB 2.0

Annotation Detail for MRPL41


View Evidences View Variants View Annotations
Basic Information Top
Gene Symbol:MRPL41 ( BMRP,MRP-L27,MRPL27,RPML27 )
Gene Full Name: mitochondrial ribosomal protein L41
Band: 9q34.3
Quick LinksEntrez ID:64975; OMIM: 611846; Uniprot ID:RM41_HUMAN; ENSEMBL ID: ENSG00000182154; HGNC ID: 14492
Relate to Another Database: SFARIGene; denovo-db
Unigene EST Top
Pool Name Gene EST/Total EST in pool Transcripts per million(TPM) Bar based on TPM
embryoid body0 / 707610 
blastocyst0 / 623190 
fetus46 / 56401281
neonate0 / 310970 
infant0 / 236200 
juvenile0 / 555560 
adult370 / 1939121190
Pool Name Gene EST/Total EST in pool Transcripts per million(TPM) Bar based on TPM
adrenal tumor1 / 1279478
bladder carcinoma0 / 174750 
breast (mammary gland) tumor113 / 941781199
cervical tumor0 / 343660 
chondrosarcoma2 / 8282324
colorectal tumor4 / 11424635
esophageal tumor0 / 172900 
gastrointestinal tumor29 / 119369242
germ cell tumor0 / 2638450 
glioma29 / 106883271
head and neck tumor0 / 1363020 
kidney tumor0 / 689590 
leukemia24 / 95842250
liver tumor6 / 9635962
lung tumor30 / 103127290
lymphoma0 / 717550 
non-neoplasia6 / 9725061
normal188 / 336030755
ovarian tumor104 / 766821356
pancreatic tumor4 / 10461638
primitive neuroectodermal tumor of the CNS2 / 12568015
prostate cancer21 / 102680204
retinoblastoma0 / 463560 
skin tumor6 / 12494948
soft tissue/muscle tissue tumor2 / 12519115
uterine tumor2 / 9025722
Pool Name Gene EST/Total EST in pool Transcripts per million(TPM) Bar based on TPM
adipose tissue0 / 131060 
adrenal gland3 / 3319790
ascites28 / 40015699
bladder0 / 297570 
blood4 / 12347832
bone0 / 716550 
bone marrow29 / 48801594
brain45 / 110098940
cervix0 / 481710 
connective tissue1 / 1492556
ear0 / 162120 
embryonic tissue2 / 2157229
esophagus0 / 202090 
eye14 / 21105466
heart9 / 89626100
intestine37 / 234472157
kidney24 / 211777113
larynx0 / 241450 
liver7 / 20774333
lung118 / 336974350
lymph0 / 442700 
lymph node4 / 9161043
mammary gland121 / 153271789
mouth1 / 6705214
muscle7 / 10771564
nerve0 / 157680 
ovary104 / 1020511019
pancreas20 / 21481293
parathyroid1 / 2053948
pharynx0 / 413280 
pituitary gland3 / 16585180
placenta3 / 28082510
prostate29 / 189345153
salivary gland0 / 201550 
skin9 / 21057442
spleen1 / 5395218
stomach1 / 9661910
testis8 / 33044224
thymus0 / 811310 
thyroid0 / 474730 
tonsil0 / 169990 
trachea0 / 524130 
umbilical cord0 / 136800 
uterus6 / 23287825
vascular1 / 5178019
Microarray in BioGPS Top
Allen Brain Atlas Top
Human Whole Brain Microarrayview in Allen Brain Atlas
  • Probe id     Donor id      
  • Probe name: CUST_4698_PI416261804
  • Donor H0351.2001
  • Sex: Male     Age: 24 years     Race/Ethnicity: African American     Handedness: Left
  • Tissue Receipt Date: 7/29/2009     Serology: Pass      Tissue pH :6.72     Additional Medical Information :History of asthma
  • Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
  • Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue Expression(mean ± stddev) Expression Bar
Amygdala8.19 ± 0.26
Basal Forebrain8.35 ± 0.21
Basal Part of Pons8.44 ± 0.33
Cerebellar Cortex7.96 ± 0.23
Cerebellar Nuclei8.3 ± 0.36
Claustrum8.01 ± 0.58
Epithalamus8.23 ± 0.42
Frontal Lobe8.4 ± 0.39
Globus Pallidus8.09 ± 0.44
Hypothalamus8.43 ± 0.34
Insula8.46 ± 0.36
Limbic Lobe8.11 ± 0.46
Mesencephalon8.25 ± 0.41
Myelencephalon8.22 ± 0.41
Occipital Lobe7.93 ± 0.43
Parietal Lobe8.33 ± 0.38
Pontine Tegmentum8.31 ± 0.39
Striatum8.5 ± 0.42
Subthalamus8.58 ± 0.31
Temporal Lobe8.44 ± 0.35
Thalamus8.39 ± 0.36
White Matter7.62 ± 0.15
Mouse Brain ISH
Peptide Top
Peptide Name Peptide Lengh Peptide Start Peptide End Peptide Sequence Source
PAp00035808 33 70 102 LKPYVSYLAPESEETPLTAAQLFSEAVAPAIEK Peptide Atlas
RM41_HUMAN_39 10 39 48 GIGFLTSGWR PRIDE

Simple Query:


  (e.g. CHD8)

Syndromic Genes

Non-syndromic Genes

AutismKB Statistics

  • Studies: 1,036
  • Genes: 1,379
  • CNVs/SVs: 5,420
  • SNVs/Indels: 11,669
  • de novo Mutations: 5,669
  • Mosaics: 789
  • Linkage Regions: 172
  • Paper Collected: 6/30/2018
  • Last Update: 8/26/2018