Annotation Detail for MRPL41


Gene Symbol: | MRPL41 ( BMRP,MRP-L27,MRPL27,RPML27 ) |
---|---|
Gene Full Name: | mitochondrial ribosomal protein L41 |
Band: | 9q34.3 |
Quick Links | Entrez ID:64975; OMIM: 611846; Uniprot ID:RM41_HUMAN; ENSEMBL ID: ENSG00000182154; HGNC ID: 14492 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.44017
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 46 / 564012 | 81 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 370 / 1939121 | 190 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 113 / 94178 | 1199 | ![]() |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 2 / 82823 | 24 | ![]() |
colorectal tumor | 4 / 114246 | 35 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 29 / 119369 | 242 | ![]() |
germ cell tumor | 0 / 263845 | 0 | |
glioma | 29 / 106883 | 271 | ![]() |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 24 / 95842 | 250 | ![]() |
liver tumor | 6 / 96359 | 62 | ![]() |
lung tumor | 30 / 103127 | 290 | ![]() |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 6 / 97250 | 61 | ![]() |
normal | 188 / 3360307 | 55 | ![]() |
ovarian tumor | 104 / 76682 | 1356 | ![]() |
pancreatic tumor | 4 / 104616 | 38 | ![]() |
primitive neuroectodermal tumor of the CNS | 2 / 125680 | 15 | ![]() |
prostate cancer | 21 / 102680 | 204 | ![]() |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 6 / 124949 | 48 | ![]() |
soft tissue/muscle tissue tumor | 2 / 125191 | 15 | ![]() |
uterine tumor | 2 / 90257 | 22 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 3 / 33197 | 90 | ![]() |
ascites | 28 / 40015 | 699 | ![]() |
bladder | 0 / 29757 | 0 | |
blood | 4 / 123478 | 32 | ![]() |
bone | 0 / 71655 | 0 | |
bone marrow | 29 / 48801 | 594 | ![]() |
brain | 45 / 1100989 | 40 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 1 / 149255 | 6 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 2 / 215722 | 9 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 14 / 211054 | 66 | ![]() |
heart | 9 / 89626 | 100 | ![]() |
intestine | 37 / 234472 | 157 | ![]() |
kidney | 24 / 211777 | 113 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 7 / 207743 | 33 | ![]() |
lung | 118 / 336974 | 350 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 4 / 91610 | 43 | ![]() |
mammary gland | 121 / 153271 | 789 | ![]() |
mouth | 1 / 67052 | 14 | ![]() |
muscle | 7 / 107715 | 64 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 104 / 102051 | 1019 | ![]() |
pancreas | 20 / 214812 | 93 | ![]() |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 3 / 16585 | 180 | ![]() |
placenta | 3 / 280825 | 10 | ![]() |
prostate | 29 / 189345 | 153 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 9 / 210574 | 42 | ![]() |
spleen | 1 / 53952 | 18 | ![]() |
stomach | 1 / 96619 | 10 | ![]() |
testis | 8 / 330442 | 24 | ![]() |
thymus | 0 / 81131 | 0 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 6 / 232878 | 25 | ![]() |
vascular | 1 / 51780 | 19 | ![]() |
- Probe name: CUST_4698_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 8.19 ± 0.26 | ![]() ![]() ![]() |
Basal Forebrain | 8.35 ± 0.21 | ![]() ![]() ![]() |
Basal Part of Pons | 8.44 ± 0.33 | ![]() ![]() ![]() |
Cerebellar Cortex | 7.96 ± 0.23 | ![]() ![]() ![]() |
Cerebellar Nuclei | 8.3 ± 0.36 | ![]() ![]() ![]() |
Claustrum | 8.01 ± 0.58 | ![]() ![]() ![]() |
Epithalamus | 8.23 ± 0.42 | ![]() ![]() ![]() |
Frontal Lobe | 8.4 ± 0.39 | ![]() ![]() ![]() |
Globus Pallidus | 8.09 ± 0.44 | ![]() ![]() ![]() |
Hypothalamus | 8.43 ± 0.34 | ![]() ![]() ![]() |
Insula | 8.46 ± 0.36 | ![]() ![]() ![]() |
Limbic Lobe | 8.11 ± 0.46 | ![]() ![]() ![]() |
Mesencephalon | 8.25 ± 0.41 | ![]() ![]() ![]() |
Myelencephalon | 8.22 ± 0.41 | ![]() ![]() ![]() |
Occipital Lobe | 7.93 ± 0.43 | ![]() ![]() ![]() |
Parietal Lobe | 8.33 ± 0.38 | ![]() ![]() ![]() |
Pontine Tegmentum | 8.31 ± 0.39 | ![]() ![]() ![]() |
Striatum | 8.5 ± 0.42 | ![]() ![]() ![]() |
Subthalamus | 8.58 ± 0.31 | ![]() ![]() ![]() |
Temporal Lobe | 8.44 ± 0.35 | ![]() ![]() ![]() |
Thalamus | 8.39 ± 0.36 | ![]() ![]() ![]() |
White Matter | 7.62 ± 0.15 | ![]() ![]() ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00035808 | 33 | 70 | 102 | LKPYVSYLAPESEETPLTAAQLFSEAVAPAIEK | Peptide Atlas |
RM41_HUMAN_39 | 10 | 39 | 48 | GIGFLTSGWR | PRIDE |