Annotation Detail for SMARCA4


Gene Symbol: | SMARCA4 ( BAF190,BRG1,FLJ39786,RTPS2,SNF2,SNF2-BETA,SNF2L4,SNF2LB,SWI2,hSNF2b ) |
---|---|
Gene Full Name: | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 |
Band: | 19p13.2 |
Quick Links | Entrez ID:6597; OMIM: 603254; Uniprot ID:SMCA4_HUMAN; ENSEMBL ID: ENSG00000127616; HGNC ID: 11100 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.327527
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 22 / 70761 | 310 | ![]() |
blastocyst | 18 / 62319 | 288 | ![]() |
fetus | 108 / 564012 | 191 | ![]() |
neonate | 3 / 31097 | 96 | ![]() |
infant | 4 / 23620 | 169 | ![]() |
juvenile | 9 / 55556 | 161 | ![]() |
adult | 330 / 1939121 | 170 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 2 / 17475 | 114 | ![]() |
breast (mammary gland) tumor | 20 / 94178 | 212 | ![]() |
cervical tumor | 6 / 34366 | 174 | ![]() |
chondrosarcoma | 7 / 82823 | 84 | ![]() |
colorectal tumor | 27 / 114246 | 236 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 15 / 119369 | 125 | ![]() |
germ cell tumor | 82 / 263845 | 310 | ![]() |
glioma | 23 / 106883 | 215 | ![]() |
head and neck tumor | 41 / 136302 | 300 | ![]() |
kidney tumor | 19 / 68959 | 275 | ![]() |
leukemia | 10 / 95842 | 104 | ![]() |
liver tumor | 4 / 96359 | 41 | ![]() |
lung tumor | 41 / 103127 | 397 | ![]() |
lymphoma | 56 / 71755 | 780 | ![]() |
non-neoplasia | 6 / 97250 | 61 | ![]() |
normal | 518 / 3360307 | 154 | ![]() |
ovarian tumor | 32 / 76682 | 417 | ![]() |
pancreatic tumor | 17 / 104616 | 162 | ![]() |
primitive neuroectodermal tumor of the CNS | 42 / 125680 | 334 | ![]() |
prostate cancer | 13 / 102680 | 126 | ![]() |
retinoblastoma | 30 / 46356 | 647 | ![]() |
skin tumor | 32 / 124949 | 256 | ![]() |
soft tissue/muscle tissue tumor | 26 / 125191 | 207 | ![]() |
uterine tumor | 13 / 90257 | 144 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 9 / 40015 | 224 | ![]() |
bladder | 4 / 29757 | 134 | ![]() |
blood | 13 / 123478 | 105 | ![]() |
bone | 5 / 71655 | 69 | ![]() |
bone marrow | 4 / 48801 | 81 | ![]() |
brain | 163 / 1100989 | 148 | ![]() |
cervix | 11 / 48171 | 228 | ![]() |
connective tissue | 7 / 149255 | 46 | ![]() |
ear | 2 / 16212 | 123 | ![]() |
embryonic tissue | 57 / 215722 | 264 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 70 / 211054 | 331 | ![]() |
heart | 21 / 89626 | 234 | ![]() |
intestine | 37 / 234472 | 157 | ![]() |
kidney | 31 / 211777 | 146 | ![]() |
larynx | 27 / 24145 | 1118 | ![]() |
liver | 7 / 207743 | 33 | ![]() |
lung | 89 / 336974 | 264 | ![]() |
lymph | 49 / 44270 | 1106 | ![]() |
lymph node | 72 / 91610 | 785 | ![]() |
mammary gland | 37 / 153271 | 241 | ![]() |
mouth | 6 / 67052 | 89 | ![]() |
muscle | 15 / 107715 | 139 | ![]() |
nerve | 2 / 15768 | 126 | ![]() |
ovary | 44 / 102051 | 431 | ![]() |
pancreas | 21 / 214812 | 97 | ![]() |
parathyroid | 10 / 20539 | 486 | ![]() |
pharynx | 2 / 41328 | 48 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 34 / 280825 | 121 | ![]() |
prostate | 23 / 189345 | 121 | ![]() |
salivary gland | 2 / 20155 | 99 | ![]() |
skin | 40 / 210574 | 189 | ![]() |
spleen | 3 / 53952 | 55 | ![]() |
stomach | 9 / 96619 | 93 | ![]() |
testis | 51 / 330442 | 154 | ![]() |
thymus | 22 / 81131 | 271 | ![]() |
thyroid | 7 / 47473 | 147 | ![]() |
tonsil | 8 / 16999 | 470 | ![]() |
trachea | 2 / 52413 | 38 | ![]() |
umbilical cord | 17 / 13680 | 1242 | ![]() |
uterus | 28 / 232878 | 120 | ![]() |
vascular | 6 / 51780 | 115 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 213720_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 95.5 | ![]() |
Adipocyte | 8.55 | ![]() |
AdrenalCortex | 10.3 | ![]() |
Adrenalgland | 10.7 | ![]() |
Amygdala | 36.4 | ![]() |
Appendix | 8.05 | ![]() |
AtrioventricularNode | 6.8 | ![]() |
BDCA4+_DentriticCells | 25.45 | ![]() |
Bonemarrow | 10 | ![]() |
BronchialEpithelialCells | 20.4 | ![]() |
CD105+_Endothelial | 45.3 | ![]() |
CD14+_Monocytes | 17 | ![]() |
CD19+_BCells(neg._sel.) | 22.15 | ![]() |
CD33+_Myeloid | 33.65 | ![]() |
CD34+ | 68.55 | ![]() |
CD4+_Tcells | 24.85 | ![]() |
CD56+_NKCells | 34.3 | ![]() |
CD71+_EarlyErythroid | 17.2 | ![]() |
CD8+_Tcells | 17.05 | ![]() |
CardiacMyocytes | 13.65 | ![]() |
Caudatenucleus | 16.3 | ![]() |
Cerebellum | 16 | ![]() |
CerebellumPeduncles | 14.35 | ![]() |
CiliaryGanglion | 5.85 | ![]() |
CingulateCortex | 14.55 | ![]() |
Colorectaladenocarcinoma | 20.25 | ![]() |
DorsalRootGanglion | 6.75 | ![]() |
FetalThyroid | 9.3 | ![]() |
Fetalbrain | 71.7 | ![]() |
Fetalliver | 9.35 | ![]() |
Fetallung | 14.5 | ![]() |
GlobusPallidus | 6.7 | ![]() |
Heart | 11.4 | ![]() |
Hypothalamus | 32.3 | ![]() |
Kidney | 8.65 | ![]() |
Leukemia_chronicMyelogenousK-562 | 64.35 | ![]() |
Leukemia_promyelocytic-HL-60 | 83.3 | ![]() |
Leukemialymphoblastic(MOLT-4) | 60.8 | ![]() |
Liver | 9.65 | ![]() |
Lung | 34.35 | ![]() |
Lymphnode | 12.55 | ![]() |
Lymphoma_burkitts(Daudi) | 66 | ![]() |
Lymphoma_burkitts(Raji) | 85.85 | ![]() |
MedullaOblongata | 10.55 | ![]() |
OccipitalLobe | 12.6 | ![]() |
OlfactoryBulb | 8 | ![]() |
Ovary | 6.1 | ![]() |
Pancreas | 9.4 | ![]() |
PancreaticIslet | 12.9 | ![]() |
ParietalLobe | 9.8 | ![]() |
Pituitary | 13.2 | ![]() |
Placenta | 14.25 | ![]() |
Pons | 8.8 | ![]() |
PrefrontalCortex | 42 | ![]() |
Prostate | 39.15 | ![]() |
Salivarygland | 7.4 | ![]() |
SkeletalMuscle | 10.25 | ![]() |
Skin | 5.2 | ![]() |
SmoothMuscle | 14.35 | ![]() |
Spinalcord | 12.95 | ![]() |
SubthalamicNucleus | 8.5 | ![]() |
SuperiorCervicalGanglion | 10.45 | ![]() |
TemporalLobe | 10.7 | ![]() |
Testis | 22.2 | ![]() |
TestisGermCell | 9.9 | ![]() |
TestisIntersitial | 7.95 | ![]() |
TestisLeydigCell | 8.45 | ![]() |
TestisSeminiferousTubule | 8.75 | ![]() |
Thalamus | 21.1 | ![]() |
Thymus | 58.7 | ![]() |
Thyroid | 14.2 | ![]() |
Tongue | 8.9 | ![]() |
Tonsil | 11.1 | ![]() |
Trachea | 8.6 | ![]() |
TrigeminalGanglion | 8.3 | ![]() |
Uterus | 14.1 | ![]() |
UterusCorpus | 7.95 | ![]() |
WholeBlood | 14.25 | ![]() |
Wholebrain | 37.5 | ![]() |
colon | 9.4 | ![]() |
pineal_day | 95.52 | ![]() |
pineal_night | 77.22 | ![]() |
retina | 24.175 | ![]() |
small_intestine | 9.05 | ![]() |
- Probe name: A_23_P39034
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 11.56 ± 0.59 | ![]() ![]() ![]() |
Basal Forebrain | 11.31 ± 0.38 | ![]() ![]() ![]() |
Basal Part of Pons | 11.13 ± 0.86 | ![]() ![]() ![]() |
Cerebellar Cortex | 10.95 ± 0.35 | ![]() ![]() ![]() |
Cerebellar Nuclei | 11.03 ± 0.34 | ![]() ![]() ![]() |
Claustrum | 12.09 ± 0.82 | ![]() ![]() ![]() |
Epithalamus | 11.01 ± 0.38 | ![]() ![]() ![]() |
Frontal Lobe | 11.22 ± 0.45 | ![]() ![]() ![]() |
Globus Pallidus | 11.67 ± 0.88 | ![]() ![]() ![]() |
Hypothalamus | 11.01 ± 0.39 | ![]() ![]() ![]() |
Insula | 11.42 ± 0.48 | ![]() ![]() ![]() |
Limbic Lobe | 11.49 ± 0.63 | ![]() ![]() ![]() |
Mesencephalon | 11.45 ± 0.55 | ![]() ![]() ![]() |
Myelencephalon | 11.31 ± 0.67 | ![]() ![]() ![]() |
Occipital Lobe | 11.09 ± 0.47 | ![]() ![]() ![]() |
Parietal Lobe | 11.35 ± 0.55 | ![]() ![]() ![]() |
Pontine Tegmentum | 11.24 ± 0.6 | ![]() ![]() ![]() |
Striatum | 11.45 ± 0.75 | ![]() ![]() ![]() |
Subthalamus | 11.5 ± 0.54 | ![]() ![]() ![]() |
Temporal Lobe | 11.3 ± 0.56 | ![]() ![]() ![]() |
Thalamus | 11.01 ± 0.41 | ![]() ![]() ![]() |
White Matter | 10.76 ± 0.15 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Smarca4 | CB | Cerebellum | 1.74 | ![]() |
1.97 | ![]() | |||
Smarca4 | CTX | Cerebral cortex | 4.22 | ![]() |
3.43 | ![]() | |||
Smarca4 | HIP | Hippocampal region | 3.65 | ![]() |
3.47 | ![]() | |||
Smarca4 | HPF | Hippocampal formation | 3.06 | ![]() |
2.71 | ![]() | |||
Smarca4 | HY | Hypothalamus | 0.29 | ![]() |
0.37 | ![]() | |||
Smarca4 | LSX | Lateral septal complex | 0.35 | ![]() |
0.5 | ![]() | |||
Smarca4 | MB | Midbrain | 0.88 | ![]() |
1.38 | ![]() | |||
Smarca4 | MY | Medulla | 1.28 | ![]() |
1.48 | ![]() | |||
Smarca4 | OLF | Olfactory bulb | 3.32 | ![]() |
3.76 | ![]() | |||
Smarca4 | P | Pons | 0.94 | ![]() |
1.55 | ![]() | |||
Smarca4 | PAL | Pallidum | 3.62 | ![]() |
5.18 | ![]() | |||
Smarca4 | RHP | Retrohippocampal region | 1.98 | ![]() |
1.56 | ![]() | |||
Smarca4 | sAMY | Striatum-like amygdalar nuclei | 0.29 | ![]() |
1.36 | ![]() | |||
Smarca4 | STR | Striatum | 0.21 | ![]() |
0.29 | ![]() | |||
Smarca4 | STRd | Striatum dorsal region | 0.18 | ![]() |
0.17 | ![]() | |||
Smarca4 | STRv | Striatum ventral region | 0.25 | ![]() |
0.21 | ![]() | |||
Smarca4 | TH | Thalamus | 1.08 | ![]() |
0.82 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00035138 | 31 | 588 | 618 | KAENAEGQTPAIGPDGEPLDETSQMSDLPVK | Peptide Atlas |
SMCA4_HUMAN_1309 | 10 | 1309 | 1318 | HEEEFDLFMR | PRIDE |
SMCA4_HUMAN_2 | 12 | 2 | 13 | STPDPPLGGTPR | PRIDE |
SMCA4_HUMAN_352 | 8 | 352 | 359 | ITPIQKPR | PRIDE |