Annotation Detail for SMARCA4
Basic Information Top
| Gene Symbol: | SMARCA4 ( BAF190,BRG1,FLJ39786,RTPS2,SNF2,SNF2-BETA,SNF2L4,SNF2LB,SWI2,hSNF2b ) |
|---|---|
| Gene Full Name: | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 |
| Band: | 19p13.2 |
| Quick Links | Entrez ID:6597; OMIM: 603254; Uniprot ID:SMCA4_HUMAN; ENSEMBL ID: ENSG00000127616; HGNC ID: 11100 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.327527
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 22 / 70761 | 310 | |
| blastocyst | 18 / 62319 | 288 | |
| fetus | 108 / 564012 | 191 | |
| neonate | 3 / 31097 | 96 | |
| infant | 4 / 23620 | 169 | |
| juvenile | 9 / 55556 | 161 | |
| adult | 330 / 1939121 | 170 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 2 / 17475 | 114 | |
| breast (mammary gland) tumor | 20 / 94178 | 212 | |
| cervical tumor | 6 / 34366 | 174 | |
| chondrosarcoma | 7 / 82823 | 84 | |
| colorectal tumor | 27 / 114246 | 236 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 15 / 119369 | 125 | |
| germ cell tumor | 82 / 263845 | 310 | |
| glioma | 23 / 106883 | 215 | |
| head and neck tumor | 41 / 136302 | 300 | |
| kidney tumor | 19 / 68959 | 275 | |
| leukemia | 10 / 95842 | 104 | |
| liver tumor | 4 / 96359 | 41 | |
| lung tumor | 41 / 103127 | 397 | |
| lymphoma | 56 / 71755 | 780 | |
| non-neoplasia | 6 / 97250 | 61 | |
| normal | 518 / 3360307 | 154 | |
| ovarian tumor | 32 / 76682 | 417 | |
| pancreatic tumor | 17 / 104616 | 162 | |
| primitive neuroectodermal tumor of the CNS | 42 / 125680 | 334 | |
| prostate cancer | 13 / 102680 | 126 | |
| retinoblastoma | 30 / 46356 | 647 | |
| skin tumor | 32 / 124949 | 256 | |
| soft tissue/muscle tissue tumor | 26 / 125191 | 207 | |
| uterine tumor | 13 / 90257 | 144 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 9 / 40015 | 224 | |
| bladder | 4 / 29757 | 134 | |
| blood | 13 / 123478 | 105 | |
| bone | 5 / 71655 | 69 | |
| bone marrow | 4 / 48801 | 81 | |
| brain | 163 / 1100989 | 148 | |
| cervix | 11 / 48171 | 228 | |
| connective tissue | 7 / 149255 | 46 | |
| ear | 2 / 16212 | 123 | |
| embryonic tissue | 57 / 215722 | 264 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 70 / 211054 | 331 | |
| heart | 21 / 89626 | 234 | |
| intestine | 37 / 234472 | 157 | |
| kidney | 31 / 211777 | 146 | |
| larynx | 27 / 24145 | 1118 | |
| liver | 7 / 207743 | 33 | |
| lung | 89 / 336974 | 264 | |
| lymph | 49 / 44270 | 1106 | |
| lymph node | 72 / 91610 | 785 | |
| mammary gland | 37 / 153271 | 241 | |
| mouth | 6 / 67052 | 89 | |
| muscle | 15 / 107715 | 139 | |
| nerve | 2 / 15768 | 126 | |
| ovary | 44 / 102051 | 431 | |
| pancreas | 21 / 214812 | 97 | |
| parathyroid | 10 / 20539 | 486 | |
| pharynx | 2 / 41328 | 48 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 34 / 280825 | 121 | |
| prostate | 23 / 189345 | 121 | |
| salivary gland | 2 / 20155 | 99 | |
| skin | 40 / 210574 | 189 | |
| spleen | 3 / 53952 | 55 | |
| stomach | 9 / 96619 | 93 | |
| testis | 51 / 330442 | 154 | |
| thymus | 22 / 81131 | 271 | |
| thyroid | 7 / 47473 | 147 | |
| tonsil | 8 / 16999 | 470 | |
| trachea | 2 / 52413 | 38 | |
| umbilical cord | 17 / 13680 | 1242 | |
| uterus | 28 / 232878 | 120 | |
| vascular | 6 / 51780 | 115 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 213720_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 95.5 | |
| Adipocyte | 8.55 | |
| AdrenalCortex | 10.3 | |
| Adrenalgland | 10.7 | |
| Amygdala | 36.4 | |
| Appendix | 8.05 | |
| AtrioventricularNode | 6.8 | |
| BDCA4+_DentriticCells | 25.45 | |
| Bonemarrow | 10 | |
| BronchialEpithelialCells | 20.4 | |
| CD105+_Endothelial | 45.3 | |
| CD14+_Monocytes | 17 | |
| CD19+_BCells(neg._sel.) | 22.15 | |
| CD33+_Myeloid | 33.65 | |
| CD34+ | 68.55 | |
| CD4+_Tcells | 24.85 | |
| CD56+_NKCells | 34.3 | |
| CD71+_EarlyErythroid | 17.2 | |
| CD8+_Tcells | 17.05 | |
| CardiacMyocytes | 13.65 | |
| Caudatenucleus | 16.3 | |
| Cerebellum | 16 | |
| CerebellumPeduncles | 14.35 | |
| CiliaryGanglion | 5.85 | |
| CingulateCortex | 14.55 | |
| Colorectaladenocarcinoma | 20.25 | |
| DorsalRootGanglion | 6.75 | |
| FetalThyroid | 9.3 | |
| Fetalbrain | 71.7 | |
| Fetalliver | 9.35 | |
| Fetallung | 14.5 | |
| GlobusPallidus | 6.7 | |
| Heart | 11.4 | |
| Hypothalamus | 32.3 | |
| Kidney | 8.65 | |
| Leukemia_chronicMyelogenousK-562 | 64.35 | |
| Leukemia_promyelocytic-HL-60 | 83.3 | |
| Leukemialymphoblastic(MOLT-4) | 60.8 | |
| Liver | 9.65 | |
| Lung | 34.35 | |
| Lymphnode | 12.55 | |
| Lymphoma_burkitts(Daudi) | 66 | |
| Lymphoma_burkitts(Raji) | 85.85 | |
| MedullaOblongata | 10.55 | |
| OccipitalLobe | 12.6 | |
| OlfactoryBulb | 8 | |
| Ovary | 6.1 | |
| Pancreas | 9.4 | |
| PancreaticIslet | 12.9 | |
| ParietalLobe | 9.8 | |
| Pituitary | 13.2 | |
| Placenta | 14.25 | |
| Pons | 8.8 | |
| PrefrontalCortex | 42 | |
| Prostate | 39.15 | |
| Salivarygland | 7.4 | |
| SkeletalMuscle | 10.25 | |
| Skin | 5.2 | |
| SmoothMuscle | 14.35 | |
| Spinalcord | 12.95 | |
| SubthalamicNucleus | 8.5 | |
| SuperiorCervicalGanglion | 10.45 | |
| TemporalLobe | 10.7 | |
| Testis | 22.2 | |
| TestisGermCell | 9.9 | |
| TestisIntersitial | 7.95 | |
| TestisLeydigCell | 8.45 | |
| TestisSeminiferousTubule | 8.75 | |
| Thalamus | 21.1 | |
| Thymus | 58.7 | |
| Thyroid | 14.2 | |
| Tongue | 8.9 | |
| Tonsil | 11.1 | |
| Trachea | 8.6 | |
| TrigeminalGanglion | 8.3 | |
| Uterus | 14.1 | |
| UterusCorpus | 7.95 | |
| WholeBlood | 14.25 | |
| Wholebrain | 37.5 | |
| colon | 9.4 | |
| pineal_day | 95.52 | |
| pineal_night | 77.22 | |
| retina | 24.175 | |
| small_intestine | 9.05 |
- Probe name: A_23_P39034
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 11.56 ± 0.59 | |
| Basal Forebrain | 11.31 ± 0.38 | |
| Basal Part of Pons | 11.13 ± 0.86 | |
| Cerebellar Cortex | 10.95 ± 0.35 | |
| Cerebellar Nuclei | 11.03 ± 0.34 | |
| Claustrum | 12.09 ± 0.82 | |
| Epithalamus | 11.01 ± 0.38 | |
| Frontal Lobe | 11.22 ± 0.45 | |
| Globus Pallidus | 11.67 ± 0.88 | |
| Hypothalamus | 11.01 ± 0.39 | |
| Insula | 11.42 ± 0.48 | |
| Limbic Lobe | 11.49 ± 0.63 | |
| Mesencephalon | 11.45 ± 0.55 | |
| Myelencephalon | 11.31 ± 0.67 | |
| Occipital Lobe | 11.09 ± 0.47 | |
| Parietal Lobe | 11.35 ± 0.55 | |
| Pontine Tegmentum | 11.24 ± 0.6 | |
| Striatum | 11.45 ± 0.75 | |
| Subthalamus | 11.5 ± 0.54 | |
| Temporal Lobe | 11.3 ± 0.56 | |
| Thalamus | 11.01 ± 0.41 | |
| White Matter | 10.76 ± 0.15 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Smarca4 | CB | Cerebellum | 1.74 | |
| 1.97 | ||||
| Smarca4 | CTX | Cerebral cortex | 4.22 | |
| 3.43 | ||||
| Smarca4 | HIP | Hippocampal region | 3.65 | |
| 3.47 | ||||
| Smarca4 | HPF | Hippocampal formation | 3.06 | |
| 2.71 | ||||
| Smarca4 | HY | Hypothalamus | 0.29 | |
| 0.37 | ||||
| Smarca4 | LSX | Lateral septal complex | 0.35 | |
| 0.5 | ||||
| Smarca4 | MB | Midbrain | 0.88 | |
| 1.38 | ||||
| Smarca4 | MY | Medulla | 1.28 | |
| 1.48 | ||||
| Smarca4 | OLF | Olfactory bulb | 3.32 | |
| 3.76 | ||||
| Smarca4 | P | Pons | 0.94 | |
| 1.55 | ||||
| Smarca4 | PAL | Pallidum | 3.62 | |
| 5.18 | ||||
| Smarca4 | RHP | Retrohippocampal region | 1.98 | |
| 1.56 | ||||
| Smarca4 | sAMY | Striatum-like amygdalar nuclei | 0.29 | |
| 1.36 | ||||
| Smarca4 | STR | Striatum | 0.21 | |
| 0.29 | ||||
| Smarca4 | STRd | Striatum dorsal region | 0.18 | |
| 0.17 | ||||
| Smarca4 | STRv | Striatum ventral region | 0.25 | |
| 0.21 | ||||
| Smarca4 | TH | Thalamus | 1.08 | |
| 0.82 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00035138 | 31 | 588 | 618 | KAENAEGQTPAIGPDGEPLDETSQMSDLPVK | Peptide Atlas |
| SMCA4_HUMAN_1309 | 10 | 1309 | 1318 | HEEEFDLFMR | PRIDE |
| SMCA4_HUMAN_2 | 12 | 2 | 13 | STPDPPLGGTPR | PRIDE |
| SMCA4_HUMAN_352 | 8 | 352 | 359 | ITPIQKPR | PRIDE |



