Annotation Detail for SPN


Gene Symbol: | SPN ( CD43,GPL115,LSN ) |
---|---|
Gene Full Name: | sialophorin |
Band: | 16p11.2 |
Quick Links | Entrez ID:6693; OMIM: 182160; Uniprot ID:LEUK_HUMAN; ENSEMBL ID: ENSG00000197471; HGNC ID: 11249 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.632188
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 10 / 564012 | 17 | ![]() |
neonate | 1 / 31097 | 32 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 2 / 55556 | 35 | ![]() |
adult | 19 / 1939121 | 9 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 1 / 94178 | 10 | ![]() |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 4 / 82823 | 48 | ![]() |
colorectal tumor | 0 / 114246 | 0 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 2 / 263845 | 7 | ![]() |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 3 / 136302 | 22 | ![]() |
kidney tumor | 1 / 68959 | 14 | ![]() |
leukemia | 9 / 95842 | 93 | ![]() |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 5 / 71755 | 69 | ![]() |
non-neoplasia | 1 / 97250 | 10 | ![]() |
normal | 40 / 3360307 | 11 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 12 / 123478 | 97 | ![]() |
bone | 2 / 71655 | 27 | ![]() |
bone marrow | 4 / 48801 | 81 | ![]() |
brain | 4 / 1100989 | 3 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 3 / 149255 | 20 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 0 / 20209 | 0 | |
eye | 0 / 211054 | 0 | |
heart | 0 / 89626 | 0 | |
intestine | 2 / 234472 | 8 | ![]() |
kidney | 1 / 211777 | 4 | ![]() |
larynx | 1 / 24145 | 41 | ![]() |
liver | 3 / 207743 | 14 | ![]() |
lung | 2 / 336974 | 5 | ![]() |
lymph | 3 / 44270 | 67 | ![]() |
lymph node | 0 / 91610 | 0 | |
mammary gland | 1 / 153271 | 6 | ![]() |
mouth | 0 / 67052 | 0 | |
muscle | 0 / 107715 | 0 | |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 0 / 280825 | 0 | |
prostate | 1 / 189345 | 5 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 1 / 210574 | 4 | ![]() |
spleen | 8 / 53952 | 148 | ![]() |
stomach | 0 / 96619 | 0 | |
testis | 0 / 330442 | 0 | |
thymus | 16 / 81131 | 197 | ![]() |
thyroid | 2 / 47473 | 42 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 1 / 13680 | 73 | ![]() |
uterus | 0 / 232878 | 0 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 206057_x_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 8 | ![]() |
Adipocyte | 6.85 | ![]() |
AdrenalCortex | 13.3 | ![]() |
Adrenalgland | 5.4 | ![]() |
Amygdala | 6.15 | ![]() |
Appendix | 15.7 | ![]() |
AtrioventricularNode | 32.1 | ![]() |
BDCA4+_DentriticCells | 7.45 | ![]() |
Bonemarrow | 8.5 | ![]() |
BronchialEpithelialCells | 6.2 | ![]() |
CD105+_Endothelial | 6.6 | ![]() |
CD14+_Monocytes | 8.4 | ![]() |
CD19+_BCells(neg._sel.) | 6.8 | ![]() |
CD33+_Myeloid | 8.4 | ![]() |
CD34+ | 8.35 | ![]() |
CD4+_Tcells | 6.45 | ![]() |
CD56+_NKCells | 45.65 | ![]() |
CD71+_EarlyErythroid | 6.05 | ![]() |
CD8+_Tcells | 5.9 | ![]() |
CardiacMyocytes | 8.1 | ![]() |
Caudatenucleus | 6.05 | ![]() |
Cerebellum | 6.1 | ![]() |
CerebellumPeduncles | 7.3 | ![]() |
CiliaryGanglion | 25.9 | ![]() |
CingulateCortex | 6.6 | ![]() |
Colorectaladenocarcinoma | 5.95 | ![]() |
DorsalRootGanglion | 31 | ![]() |
FetalThyroid | 6.45 | ![]() |
Fetalbrain | 6.45 | ![]() |
Fetalliver | 6.15 | ![]() |
Fetallung | 5.3 | ![]() |
GlobusPallidus | 12.8 | ![]() |
Heart | 7.75 | ![]() |
Hypothalamus | 7.25 | ![]() |
Kidney | 5.25 | ![]() |
Leukemia_chronicMyelogenousK-562 | 6.1 | ![]() |
Leukemia_promyelocytic-HL-60 | 5.65 | ![]() |
Leukemialymphoblastic(MOLT-4) | 5.7 | ![]() |
Liver | 8.2 | ![]() |
Lung | 6.7 | ![]() |
Lymphnode | 5.7 | ![]() |
Lymphoma_burkitts(Daudi) | 8.1 | ![]() |
Lymphoma_burkitts(Raji) | 8.7 | ![]() |
MedullaOblongata | 6.05 | ![]() |
OccipitalLobe | 6.05 | ![]() |
OlfactoryBulb | 5.4 | ![]() |
Ovary | 8.3 | ![]() |
Pancreas | 5.05 | ![]() |
PancreaticIslet | 6.6 | ![]() |
ParietalLobe | 6.75 | ![]() |
Pituitary | 8.3 | ![]() |
Placenta | 6.3 | ![]() |
Pons | 7.55 | ![]() |
PrefrontalCortex | 5.5 | ![]() |
Prostate | 6.9 | ![]() |
Salivarygland | 20.35 | ![]() |
SkeletalMuscle | 12 | ![]() |
Skin | 24.1 | ![]() |
SmoothMuscle | 8.4 | ![]() |
Spinalcord | 6.9 | ![]() |
SubthalamicNucleus | 8.9 | ![]() |
SuperiorCervicalGanglion | 48.6 | ![]() |
TemporalLobe | 7.25 | ![]() |
Testis | 5.5 | ![]() |
TestisGermCell | 5.45 | ![]() |
TestisIntersitial | 7.2 | ![]() |
TestisLeydigCell | 25.65 | ![]() |
TestisSeminiferousTubule | 26.05 | ![]() |
Thalamus | 6.5 | ![]() |
Thymus | 5.5 | ![]() |
Thyroid | 7.4 | ![]() |
Tongue | 16.05 | ![]() |
Tonsil | 7.45 | ![]() |
Trachea | 5.5 | ![]() |
TrigeminalGanglion | 26.75 | ![]() |
Uterus | 5.1 | ![]() |
UterusCorpus | 9.35 | ![]() |
WholeBlood | 7.45 | ![]() |
Wholebrain | 4.95 | ![]() |
colon | 5.95 | ![]() |
pineal_day | 6.1 | ![]() |
pineal_night | 6.08 | ![]() |
retina | 7.65 | ![]() |
small_intestine | 4.85 | ![]() |
- Probe name: A_23_P433760
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 6.1 ± 0.68 | ![]() ![]() ![]() |
Basal Forebrain | 6.11 ± 0.3 | ![]() ![]() ![]() |
Basal Part of Pons | 5.72 ± 0.42 | ![]() ![]() ![]() |
Cerebellar Cortex | 5.32 ± 0.52 | ![]() ![]() ![]() |
Cerebellar Nuclei | 6.46 ± 0.6 | ![]() ![]() ![]() |
Claustrum | 6.51 ± 0.79 | ![]() ![]() ![]() |
Epithalamus | 4.81 ± 0.75 | ![]() ![]() ![]() |
Frontal Lobe | 5.88 ± 0.71 | ![]() ![]() ![]() |
Globus Pallidus | 6.52 ± 0.33 | ![]() ![]() ![]() |
Hypothalamus | 5.62 ± 0.8 | ![]() ![]() ![]() |
Insula | 5.64 ± 0.67 | ![]() ![]() ![]() |
Limbic Lobe | 5.9 ± 0.74 | ![]() ![]() ![]() |
Mesencephalon | 6.13 ± 0.52 | ![]() ![]() ![]() |
Myelencephalon | 6.02 ± 0.79 | ![]() ![]() ![]() |
Occipital Lobe | 5.96 ± 0.88 | ![]() ![]() ![]() |
Parietal Lobe | 5.93 ± 0.58 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.91 ± 0.6 | ![]() ![]() ![]() |
Striatum | 6.57 ± 0.67 | ![]() ![]() ![]() |
Subthalamus | 6.23 ± 0.4 | ![]() ![]() ![]() |
Temporal Lobe | 5.68 ± 0.68 | ![]() ![]() ![]() |
Thalamus | 6.26 ± 0.51 | ![]() ![]() ![]() |
White Matter | 5.87 ± 0.15 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Spn | CB | Cerebellum | 1.04 | ![]() |
1.6 | ![]() | |||
Spn | CTX | Cerebral cortex | 2.22 | ![]() |
3.07 | ![]() | |||
Spn | HIP | Hippocampal region | 0.79 | ![]() |
1.05 | ![]() | |||
Spn | HPF | Hippocampal formation | 0.96 | ![]() |
1.67 | ![]() | |||
Spn | HY | Hypothalamus | 0.66 | ![]() |
0.92 | ![]() | |||
Spn | LSX | Lateral septal complex | 2.26 | ![]() |
1.56 | ![]() | |||
Spn | MB | Midbrain | 0.85 | ![]() |
0.99 | ![]() | |||
Spn | MY | Medulla | 2.93 | ![]() |
3.45 | ![]() | |||
Spn | OLF | Olfactory bulb | 1.11 | ![]() |
1.13 | ![]() | |||
Spn | P | Pons | 1.17 | ![]() |
1.1 | ![]() | |||
Spn | PAL | Pallidum | 1.45 | ![]() |
1.57 | ![]() | |||
Spn | RHP | Retrohippocampal region | 1.3 | ![]() |
2.73 | ![]() | |||
Spn | sAMY | Striatum-like amygdalar nuclei | 0.56 | ![]() |
0.8 | ![]() | |||
Spn | STR | Striatum | 0.97 | ![]() |
1.06 | ![]() | |||
Spn | STRd | Striatum dorsal region | 0.91 | ![]() |
1.06 | ![]() | |||
Spn | STRv | Striatum ventral region | 0.73 | ![]() |
0.9 | ![]() | |||
Spn | TH | Thalamus | 1.02 | ![]() |
1.24 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
LEUK_HUMAN_0 | 0 | 0 | 0 | RPTLTTFFGR | PRIDE |
PAp00006768 | 31 | 296 | 326 | RNGVVDAWAGPAQVPEEGAVTVTVGGSGGDK | Peptide Atlas |