Annotation Detail for ADAM17


Gene Symbol: | ADAM17 ( ADAM18,CD156B,CSVP,MGC71942,TACE ) |
---|---|
Gene Full Name: | ADAM metallopeptidase domain 17 |
Band: | 2p25.1 |
Quick Links | Entrez ID:6868; OMIM: 603639; Uniprot ID:ADA17_HUMAN; ENSEMBL ID: ENSG00000151694; HGNC ID: 195 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.404914
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 1 / 70761 | 14 | ![]() |
blastocyst | 2 / 62319 | 32 | ![]() |
fetus | 4 / 564012 | 7 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 36 / 1939121 | 18 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 1 / 17475 | 57 | ![]() |
breast (mammary gland) tumor | 1 / 94178 | 10 | ![]() |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 1 / 82823 | 12 | ![]() |
colorectal tumor | 1 / 114246 | 8 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 1 / 119369 | 8 | ![]() |
germ cell tumor | 3 / 263845 | 11 | ![]() |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 3 / 136302 | 22 | ![]() |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 0 / 97250 | 0 | |
normal | 42 / 3360307 | 12 | ![]() |
ovarian tumor | 3 / 76682 | 39 | ![]() |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 1 / 125191 | 7 | ![]() |
uterine tumor | 6 / 90257 | 66 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 1 / 40015 | 24 | ![]() |
bladder | 1 / 29757 | 33 | ![]() |
blood | 0 / 123478 | 0 | |
bone | 0 / 71655 | 0 | |
bone marrow | 1 / 48801 | 20 | ![]() |
brain | 8 / 1100989 | 7 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 2 / 149255 | 13 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 3 / 215722 | 13 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 6 / 211054 | 28 | ![]() |
heart | 0 / 89626 | 0 | |
intestine | 1 / 234472 | 4 | ![]() |
kidney | 1 / 211777 | 4 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 1 / 207743 | 4 | ![]() |
lung | 9 / 336974 | 26 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 1 / 91610 | 10 | ![]() |
mammary gland | 6 / 153271 | 39 | ![]() |
mouth | 3 / 67052 | 44 | ![]() |
muscle | 1 / 107715 | 9 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 3 / 102051 | 29 | ![]() |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 3 / 280825 | 10 | ![]() |
prostate | 1 / 189345 | 5 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 0 / 210574 | 0 | |
spleen | 2 / 53952 | 37 | ![]() |
stomach | 0 / 96619 | 0 | |
testis | 4 / 330442 | 12 | ![]() |
thymus | 2 / 81131 | 24 | ![]() |
thyroid | 1 / 47473 | 21 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 10 / 232878 | 42 | ![]() |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 205746_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 6.7 | ![]() |
Adipocyte | 5.75 | ![]() |
AdrenalCortex | 6.75 | ![]() |
Adrenalgland | 5.3 | ![]() |
Amygdala | 5.95 | ![]() |
Appendix | 6.65 | ![]() |
AtrioventricularNode | 5.15 | ![]() |
BDCA4+_DentriticCells | 5.95 | ![]() |
Bonemarrow | 6.2 | ![]() |
BronchialEpithelialCells | 5.75 | ![]() |
CD105+_Endothelial | 5.85 | ![]() |
CD14+_Monocytes | 6.2 | ![]() |
CD19+_BCells(neg._sel.) | 6 | ![]() |
CD33+_Myeloid | 7.4 | ![]() |
CD34+ | 7.2 | ![]() |
CD4+_Tcells | 6.05 | ![]() |
CD56+_NKCells | 6.6 | ![]() |
CD71+_EarlyErythroid | 5.55 | ![]() |
CD8+_Tcells | 5.35 | ![]() |
CardiacMyocytes | 8.1 | ![]() |
Caudatenucleus | 5.3 | ![]() |
Cerebellum | 4.8 | ![]() |
CerebellumPeduncles | 6.95 | ![]() |
CiliaryGanglion | 4.7 | ![]() |
CingulateCortex | 6.15 | ![]() |
Colorectaladenocarcinoma | 6.1 | ![]() |
DorsalRootGanglion | 4.95 | ![]() |
FetalThyroid | 5.75 | ![]() |
Fetalbrain | 5.9 | ![]() |
Fetalliver | 5.25 | ![]() |
Fetallung | 4.95 | ![]() |
GlobusPallidus | 4.5 | ![]() |
Heart | 7.8 | ![]() |
Hypothalamus | 6.2 | ![]() |
Kidney | 5.2 | ![]() |
Leukemia_chronicMyelogenousK-562 | 5.3 | ![]() |
Leukemia_promyelocytic-HL-60 | 5.4 | ![]() |
Leukemialymphoblastic(MOLT-4) | 4.75 | ![]() |
Liver | 8.4 | ![]() |
Lung | 6.4 | ![]() |
Lymphnode | 5.05 | ![]() |
Lymphoma_burkitts(Daudi) | 7.75 | ![]() |
Lymphoma_burkitts(Raji) | 8.65 | ![]() |
MedullaOblongata | 5.35 | ![]() |
OccipitalLobe | 5.25 | ![]() |
OlfactoryBulb | 4.65 | ![]() |
Ovary | 4.2 | ![]() |
Pancreas | 4.85 | ![]() |
PancreaticIslet | 6.3 | ![]() |
ParietalLobe | 6.45 | ![]() |
Pituitary | 6.9 | ![]() |
Placenta | 6.2 | ![]() |
Pons | 5.85 | ![]() |
PrefrontalCortex | 7.15 | ![]() |
Prostate | 6.7 | ![]() |
Salivarygland | 4.85 | ![]() |
SkeletalMuscle | 8.45 | ![]() |
Skin | 4.95 | ![]() |
SmoothMuscle | 6.65 | ![]() |
Spinalcord | 6.3 | ![]() |
SubthalamicNucleus | 5.5 | ![]() |
SuperiorCervicalGanglion | 7.85 | ![]() |
TemporalLobe | 5.55 | ![]() |
Testis | 5.3 | ![]() |
TestisGermCell | 5 | ![]() |
TestisIntersitial | 5.05 | ![]() |
TestisLeydigCell | 6.25 | ![]() |
TestisSeminiferousTubule | 5.1 | ![]() |
Thalamus | 6 | ![]() |
Thymus | 4.5 | ![]() |
Thyroid | 7.15 | ![]() |
Tongue | 6.2 | ![]() |
Tonsil | 5.85 | ![]() |
Trachea | 4.9 | ![]() |
TrigeminalGanglion | 6.7 | ![]() |
Uterus | 4.65 | ![]() |
UterusCorpus | 5.8 | ![]() |
WholeBlood | 6.4 | ![]() |
Wholebrain | 4.8 | ![]() |
colon | 5.9 | ![]() |
pineal_day | 7.14 | ![]() |
pineal_night | 7.08 | ![]() |
retina | 7.125 | ![]() |
small_intestine | 5.65 | ![]() |
- Probe name: A_23_P143120
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 6.26 ± 0.37 | ![]() ![]() ![]() |
Basal Forebrain | 6.68 ± 0.23 | ![]() ![]() ![]() |
Basal Part of Pons | 6.13 ± 0.33 | ![]() ![]() ![]() |
Cerebellar Cortex | 6.24 ± 0.24 | ![]() ![]() ![]() |
Cerebellar Nuclei | 6.42 ± 0.4 | ![]() ![]() ![]() |
Claustrum | 6.22 ± 0.49 | ![]() ![]() ![]() |
Epithalamus | 6.66 ± 0.46 | ![]() ![]() ![]() |
Frontal Lobe | 6.3 ± 0.31 | ![]() ![]() ![]() |
Globus Pallidus | 6.92 ± 0.29 | ![]() ![]() ![]() |
Hypothalamus | 6.43 ± 0.53 | ![]() ![]() ![]() |
Insula | 6.3 ± 0.29 | ![]() ![]() ![]() |
Limbic Lobe | 6.24 ± 0.33 | ![]() ![]() ![]() |
Mesencephalon | 6.52 ± 0.27 | ![]() ![]() ![]() |
Myelencephalon | 6.38 ± 0.33 | ![]() ![]() ![]() |
Occipital Lobe | 6.57 ± 0.25 | ![]() ![]() ![]() |
Parietal Lobe | 6.32 ± 0.28 | ![]() ![]() ![]() |
Pontine Tegmentum | 6.25 ± 0.34 | ![]() ![]() ![]() |
Striatum | 6.39 ± 0.25 | ![]() ![]() ![]() |
Subthalamus | 6.19 ± 0.07 | ![]() ![]() ![]() |
Temporal Lobe | 6.25 ± 0.31 | ![]() ![]() ![]() |
Thalamus | 6.34 ± 0.29 | ![]() ![]() ![]() |
White Matter | 7.4 ± 0.43 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Adam17 | CB | Cerebellum | 2.95 | ![]() |
4.6 | ![]() | |||
Adam17 | CTX | Cerebral cortex | 2.94 | ![]() |
2.57 | ![]() | |||
Adam17 | HIP | Hippocampal region | 0.6 | ![]() |
0.56 | ![]() | |||
Adam17 | HPF | Hippocampal formation | 0.72 | ![]() |
0.62 | ![]() | |||
Adam17 | HY | Hypothalamus | 0.39 | ![]() |
0.24 | ![]() | |||
Adam17 | LSX | Lateral septal complex | 1.04 | ![]() |
0.82 | ![]() | |||
Adam17 | MB | Midbrain | 1.49 | ![]() |
1.65 | ![]() | |||
Adam17 | MY | Medulla | 1.99 | ![]() |
1.82 | ![]() | |||
Adam17 | OLF | Olfactory bulb | 2.56 | ![]() |
1.98 | ![]() | |||
Adam17 | P | Pons | 0.86 | ![]() |
0.75 | ![]() | |||
Adam17 | PAL | Pallidum | 0.63 | ![]() |
0.61 | ![]() | |||
Adam17 | RHP | Retrohippocampal region | 0.87 | ![]() |
0.73 | ![]() | |||
Adam17 | sAMY | Striatum-like amygdalar nuclei | 0.39 | ![]() |
0.13 | ![]() | |||
Adam17 | STR | Striatum | 0.89 | ![]() |
0.73 | ![]() | |||
Adam17 | STRd | Striatum dorsal region | 0.95 | ![]() |
0.76 | ![]() | |||
Adam17 | STRv | Striatum ventral region | 0.97 | ![]() |
0.94 | ![]() | |||
Adam17 | TH | Thalamus | 1.15 | ![]() |
1.09 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
ADA17_HUMAN_18 | 14 | 18 | 31 | PRPPDDPGFGPHQR | PRIDE |
PAp00095644 | 35 | 398 | 432 | EADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGK | Peptide Atlas |