Annotation Detail for TAP1


Gene Symbol: | TAP1 ( ABC17,ABCB2,APT1,D6S114E,FLJ26666,FLJ41500,PSF1,RING4,TAP1*0102N,TAP1N ) |
---|---|
Gene Full Name: | transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) |
Band: | 6p21.32 |
Quick Links | Entrez ID:6890; OMIM: 170260; Uniprot ID:TAP1_HUMAN; ENSEMBL ID: ENSG00000168394; HGNC ID: 43 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.352018
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 1 / 70761 | 14 | ![]() |
blastocyst | 1 / 62319 | 16 | ![]() |
fetus | 9 / 564012 | 15 | ![]() |
neonate | 3 / 31097 | 96 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 5 / 55556 | 89 | ![]() |
adult | 216 / 1939121 | 111 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 1 / 17475 | 57 | ![]() |
breast (mammary gland) tumor | 11 / 94178 | 116 | ![]() |
cervical tumor | 3 / 34366 | 87 | ![]() |
chondrosarcoma | 10 / 82823 | 120 | ![]() |
colorectal tumor | 14 / 114246 | 122 | ![]() |
esophageal tumor | 8 / 17290 | 462 | ![]() |
gastrointestinal tumor | 13 / 119369 | 108 | ![]() |
germ cell tumor | 28 / 263845 | 106 | ![]() |
glioma | 15 / 106883 | 140 | ![]() |
head and neck tumor | 6 / 136302 | 44 | ![]() |
kidney tumor | 5 / 68959 | 72 | ![]() |
leukemia | 10 / 95842 | 104 | ![]() |
liver tumor | 11 / 96359 | 114 | ![]() |
lung tumor | 6 / 103127 | 58 | ![]() |
lymphoma | 13 / 71755 | 181 | ![]() |
non-neoplasia | 8 / 97250 | 82 | ![]() |
normal | 295 / 3360307 | 87 | ![]() |
ovarian tumor | 3 / 76682 | 39 | ![]() |
pancreatic tumor | 11 / 104616 | 105 | ![]() |
primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | ![]() |
prostate cancer | 8 / 102680 | 77 | ![]() |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 22 / 124949 | 176 | ![]() |
soft tissue/muscle tissue tumor | 2 / 125191 | 15 | ![]() |
uterine tumor | 29 / 90257 | 321 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 2 / 33197 | 60 | ![]() |
ascites | 4 / 40015 | 99 | ![]() |
bladder | 8 / 29757 | 268 | ![]() |
blood | 33 / 123478 | 267 | ![]() |
bone | 8 / 71655 | 111 | ![]() |
bone marrow | 2 / 48801 | 40 | ![]() |
brain | 69 / 1100989 | 62 | ![]() |
cervix | 12 / 48171 | 249 | ![]() |
connective tissue | 10 / 149255 | 66 | ![]() |
ear | 2 / 16212 | 123 | ![]() |
embryonic tissue | 2 / 215722 | 9 | ![]() |
esophagus | 8 / 20209 | 395 | ![]() |
eye | 5 / 211054 | 23 | ![]() |
heart | 3 / 89626 | 33 | ![]() |
intestine | 33 / 234472 | 140 | ![]() |
kidney | 25 / 211777 | 118 | ![]() |
larynx | 2 / 24145 | 82 | ![]() |
liver | 18 / 207743 | 86 | ![]() |
lung | 35 / 336974 | 103 | ![]() |
lymph | 3 / 44270 | 67 | ![]() |
lymph node | 17 / 91610 | 185 | ![]() |
mammary gland | 14 / 153271 | 91 | ![]() |
mouth | 3 / 67052 | 44 | ![]() |
muscle | 6 / 107715 | 55 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 5 / 102051 | 48 | ![]() |
pancreas | 12 / 214812 | 55 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 2 / 41328 | 48 | ![]() |
pituitary gland | 0 / 16585 | 0 | |
placenta | 16 / 280825 | 56 | ![]() |
prostate | 17 / 189345 | 89 | ![]() |
salivary gland | 2 / 20155 | 99 | ![]() |
skin | 29 / 210574 | 137 | ![]() |
spleen | 23 / 53952 | 426 | ![]() |
stomach | 4 / 96619 | 41 | ![]() |
testis | 17 / 330442 | 51 | ![]() |
thymus | 33 / 81131 | 406 | ![]() |
thyroid | 3 / 47473 | 63 | ![]() |
tonsil | 1 / 16999 | 58 | ![]() |
trachea | 7 / 52413 | 133 | ![]() |
umbilical cord | 1 / 13680 | 73 | ![]() |
uterus | 51 / 232878 | 218 | ![]() |
vascular | 3 / 51780 | 57 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202307_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 793.5 | ![]() |
Adipocyte | 53.25 | ![]() |
AdrenalCortex | 55.75 | ![]() |
Adrenalgland | 46.75 | ![]() |
Amygdala | 49.55 | ![]() |
Appendix | 54.3 | ![]() |
AtrioventricularNode | 27.05 | ![]() |
BDCA4+_DentriticCells | 762.8 | ![]() |
Bonemarrow | 63.65 | ![]() |
BronchialEpithelialCells | 54.05 | ![]() |
CD105+_Endothelial | 54.7 | ![]() |
CD14+_Monocytes | 411.7 | ![]() |
CD19+_BCells(neg._sel.) | 329.55 | ![]() |
CD33+_Myeloid | 320.45 | ![]() |
CD34+ | 118.1 | ![]() |
CD4+_Tcells | 665.75 | ![]() |
CD56+_NKCells | 692.9 | ![]() |
CD71+_EarlyErythroid | 23.45 | ![]() |
CD8+_Tcells | 662.2 | ![]() |
CardiacMyocytes | 67.6 | ![]() |
Caudatenucleus | 37.65 | ![]() |
Cerebellum | 35.15 | ![]() |
CerebellumPeduncles | 51.85 | ![]() |
CiliaryGanglion | 37.5 | ![]() |
CingulateCortex | 18.2 | ![]() |
Colorectaladenocarcinoma | 56.75 | ![]() |
DorsalRootGanglion | 40.95 | ![]() |
FetalThyroid | 41.35 | ![]() |
Fetalbrain | 37.75 | ![]() |
Fetalliver | 29.2 | ![]() |
Fetallung | 45.6 | ![]() |
GlobusPallidus | 32.8 | ![]() |
Heart | 84.05 | ![]() |
Hypothalamus | 58.85 | ![]() |
Kidney | 37.1 | ![]() |
Leukemia_chronicMyelogenousK-562 | 39.05 | ![]() |
Leukemia_promyelocytic-HL-60 | 87.35 | ![]() |
Leukemialymphoblastic(MOLT-4) | 44.6 | ![]() |
Liver | 71 | ![]() |
Lung | 182.55 | ![]() |
Lymphnode | 298.7 | ![]() |
Lymphoma_burkitts(Daudi) | 291.85 | ![]() |
Lymphoma_burkitts(Raji) | 170.8 | ![]() |
MedullaOblongata | 39.15 | ![]() |
OccipitalLobe | 24.25 | ![]() |
OlfactoryBulb | 42.7 | ![]() |
Ovary | 22.65 | ![]() |
Pancreas | 43.65 | ![]() |
PancreaticIslet | 76.9 | ![]() |
ParietalLobe | 43.65 | ![]() |
Pituitary | 55.8 | ![]() |
Placenta | 56.5 | ![]() |
Pons | 40.2 | ![]() |
PrefrontalCortex | 66.75 | ![]() |
Prostate | 76.4 | ![]() |
Salivarygland | 58.9 | ![]() |
SkeletalMuscle | 61.35 | ![]() |
Skin | 41.8 | ![]() |
SmoothMuscle | 61.7 | ![]() |
Spinalcord | 57.8 | ![]() |
SubthalamicNucleus | 39.8 | ![]() |
SuperiorCervicalGanglion | 60.15 | ![]() |
TemporalLobe | 36.3 | ![]() |
Testis | 47.75 | ![]() |
TestisGermCell | 50.45 | ![]() |
TestisIntersitial | 27.2 | ![]() |
TestisLeydigCell | 48.7 | ![]() |
TestisSeminiferousTubule | 41.85 | ![]() |
Thalamus | 50.5 | ![]() |
Thymus | 147.2 | ![]() |
Thyroid | 68.7 | ![]() |
Tongue | 60.3 | ![]() |
Tonsil | 216.5 | ![]() |
Trachea | 45.8 | ![]() |
TrigeminalGanglion | 53.45 | ![]() |
Uterus | 44.65 | ![]() |
UterusCorpus | 48.15 | ![]() |
WholeBlood | 535.2 | ![]() |
Wholebrain | 45.05 | ![]() |
colon | 98.6 | ![]() |
pineal_day | 102.32 | ![]() |
pineal_night | 90.48 | ![]() |
retina | 65.875 | ![]() |
small_intestine | 71.45 | ![]() |
- Probe name: CUST_648_PI416408490
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 2.38 ± 0.84 | ![]() ![]() ![]() |
Basal Forebrain | 2.05 ± 0.47 | ![]() ![]() ![]() |
Basal Part of Pons | 2.21 ± 0.8 | ![]() ![]() ![]() |
Cerebellar Cortex | 2.02 ± 0.6 | ![]() ![]() ![]() |
Cerebellar Nuclei | 2.54 ± 0.63 | ![]() ![]() ![]() |
Claustrum | 2.68 ± 0.69 | ![]() ![]() ![]() |
Epithalamus | 2.36 ± 0.76 | ![]() ![]() ![]() |
Frontal Lobe | 2.09 ± 0.72 | ![]() ![]() ![]() |
Globus Pallidus | 3.38 ± 0.7 | ![]() ![]() ![]() |
Hypothalamus | 1.98 ± 0.81 | ![]() ![]() ![]() |
Insula | 2.06 ± 0.68 | ![]() ![]() ![]() |
Limbic Lobe | 2.19 ± 0.63 | ![]() ![]() ![]() |
Mesencephalon | 2.26 ± 0.71 | ![]() ![]() ![]() |
Myelencephalon | 2.42 ± 0.75 | ![]() ![]() ![]() |
Occipital Lobe | 2.58 ± 0.8 | ![]() ![]() ![]() |
Parietal Lobe | 2.31 ± 0.78 | ![]() ![]() ![]() |
Pontine Tegmentum | 2.28 ± 0.67 | ![]() ![]() ![]() |
Striatum | 2.65 ± 0.76 | ![]() ![]() ![]() |
Subthalamus | 2.15 ± 0.45 | ![]() ![]() ![]() |
Temporal Lobe | 2.11 ± 0.75 | ![]() ![]() ![]() |
Thalamus | 2.71 ± 0.69 | ![]() ![]() ![]() |
White Matter | 3.16 ± 0.59 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Tap1 | CB | Cerebellum | 0.24 | ![]() |
0.41 | ![]() | |||
Tap1 | CTX | Cerebral cortex | 0.16 | ![]() |
0.38 | ![]() | |||
Tap1 | HIP | Hippocampal region | 0.11 | ![]() |
0.16 | ![]() | |||
Tap1 | HPF | Hippocampal formation | 0.11 | ![]() |
0.16 | ![]() | |||
Tap1 | HY | Hypothalamus | 0.26 | ![]() |
0.41 | ![]() | |||
Tap1 | LSX | Lateral septal complex | 0.06 | ![]() |
0.08 | ![]() | |||
Tap1 | MB | Midbrain | 0.23 | ![]() |
0.45 | ![]() | |||
Tap1 | MY | Medulla | 1.5 | ![]() |
2.25 | ![]() | |||
Tap1 | OLF | Olfactory bulb | 0.64 | ![]() |
1.88 | ![]() | |||
Tap1 | P | Pons | 1.41 | ![]() |
4.48 | ![]() | |||
Tap1 | PAL | Pallidum | 0.05 | ![]() |
0.04 | ![]() | |||
Tap1 | RHP | Retrohippocampal region | 0.11 | ![]() |
0.18 | ![]() | |||
Tap1 | sAMY | Striatum-like amygdalar nuclei | 0.18 | ![]() |
0.17 | ![]() | |||
Tap1 | STR | Striatum | 0.08 | ![]() |
0.1 | ![]() | |||
Tap1 | STRd | Striatum dorsal region | 0.05 | ![]() |
0.11 | ![]() | |||
Tap1 | STRv | Striatum ventral region | 0.11 | ![]() |
0.04 | ![]() | |||
Tap1 | TH | Thalamus | 0.31 | ![]() |
0.63 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00004505 | 32 | 720 | 751 | KPCVLILDDATSALDANSQLQVEQLLYESPER | Peptide Atlas |
TAP1_HUMAN_0 | 0 | 0 | 0 | STVAALLQNLYQPTGGQLLLDGKPLPQYEHR | PRIDE |
TAP1_HUMAN_363 | 16 | 363 | 378 | SSQVAIEALSAMPTVR | PRIDE |
TAP1_HUMAN_544 | 31 | 544 | 574 | STVAALLQNLYQPTGGQLLLDGKPLPQYEHR | PRIDE |
TAP1_HUMAN_580 | 14 | 580 | 593 | QVAAVGQEPQVFGR | PRIDE |