Annotation Detail for TGFBI


Gene Symbol: | TGFBI ( BIGH3,CDB1,CDG2,CDGG1,CSD,CSD1,CSD2,CSD3,EBMD,LCD1 ) |
---|---|
Gene Full Name: | transforming growth factor, beta-induced, 68kDa |
Band: | 5q31.1 |
Quick Links | Entrez ID:7045; OMIM: 601692; Uniprot ID:BGH3_HUMAN; ENSEMBL ID: ENSG00000120708; HGNC ID: 11771 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.369397
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 73 / 70761 | 1031 | ![]() |
blastocyst | 19 / 62319 | 304 | ![]() |
fetus | 159 / 564012 | 281 | ![]() |
neonate | 59 / 31097 | 1897 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 8 / 55556 | 143 | ![]() |
adult | 1076 / 1939121 | 554 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 2 / 12794 | 156 | ![]() |
bladder carcinoma | 1 / 17475 | 57 | ![]() |
breast (mammary gland) tumor | 16 / 94178 | 169 | ![]() |
cervical tumor | 16 / 34366 | 465 | ![]() |
chondrosarcoma | 227 / 82823 | 2740 | ![]() |
colorectal tumor | 80 / 114246 | 700 | ![]() |
esophageal tumor | 12 / 17290 | 694 | ![]() |
gastrointestinal tumor | 11 / 119369 | 92 | ![]() |
germ cell tumor | 141 / 263845 | 534 | ![]() |
glioma | 253 / 106883 | 2367 | ![]() |
head and neck tumor | 197 / 136302 | 1445 | ![]() |
kidney tumor | 335 / 68959 | 4857 | ![]() |
leukemia | 44 / 95842 | 459 | ![]() |
liver tumor | 48 / 96359 | 498 | ![]() |
lung tumor | 75 / 103127 | 727 | ![]() |
lymphoma | 2 / 71755 | 27 | ![]() |
non-neoplasia | 237 / 97250 | 2437 | ![]() |
normal | 2270 / 3360307 | 675 | ![]() |
ovarian tumor | 3 / 76682 | 39 | ![]() |
pancreatic tumor | 114 / 104616 | 1089 | ![]() |
primitive neuroectodermal tumor of the CNS | 5 / 125680 | 39 | ![]() |
prostate cancer | 29 / 102680 | 282 | ![]() |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 39 / 124949 | 312 | ![]() |
soft tissue/muscle tissue tumor | 9 / 125191 | 71 | ![]() |
uterine tumor | 17 / 90257 | 188 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 4 / 13106 | 305 | ![]() |
adrenal gland | 4 / 33197 | 120 | ![]() |
ascites | 0 / 40015 | 0 | |
bladder | 2 / 29757 | 67 | ![]() |
blood | 17 / 123478 | 137 | ![]() |
bone | 35 / 71655 | 488 | ![]() |
bone marrow | 38 / 48801 | 778 | ![]() |
brain | 868 / 1100989 | 788 | ![]() |
cervix | 18 / 48171 | 373 | ![]() |
connective tissue | 453 / 149255 | 3035 | ![]() |
ear | 6 / 16212 | 370 | ![]() |
embryonic tissue | 128 / 215722 | 593 | ![]() |
esophagus | 13 / 20209 | 643 | ![]() |
eye | 174 / 211054 | 824 | ![]() |
heart | 32 / 89626 | 357 | ![]() |
intestine | 124 / 234472 | 528 | ![]() |
kidney | 435 / 211777 | 2054 | ![]() |
larynx | 11 / 24145 | 455 | ![]() |
liver | 64 / 207743 | 308 | ![]() |
lung | 321 / 336974 | 952 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 6 / 91610 | 65 | ![]() |
mammary gland | 28 / 153271 | 182 | ![]() |
mouth | 105 / 67052 | 1565 | ![]() |
muscle | 8 / 107715 | 74 | ![]() |
nerve | 4 / 15768 | 253 | ![]() |
ovary | 6 / 102051 | 58 | ![]() |
pancreas | 116 / 214812 | 540 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 53 / 41328 | 1282 | ![]() |
pituitary gland | 2 / 16585 | 120 | ![]() |
placenta | 219 / 280825 | 779 | ![]() |
prostate | 39 / 189345 | 205 | ![]() |
salivary gland | 11 / 20155 | 545 | ![]() |
skin | 334 / 210574 | 1586 | ![]() |
spleen | 61 / 53952 | 1130 | ![]() |
stomach | 13 / 96619 | 134 | ![]() |
testis | 27 / 330442 | 81 | ![]() |
thymus | 40 / 81131 | 493 | ![]() |
thyroid | 35 / 47473 | 737 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 14 / 52413 | 267 | ![]() |
umbilical cord | 13 / 13680 | 950 | ![]() |
uterus | 48 / 232878 | 206 | ![]() |
vascular | 140 / 51780 | 2703 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201506_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 6.15 | ![]() |
Adipocyte | 964.15 | ![]() |
AdrenalCortex | 33.15 | ![]() |
Adrenalgland | 69.4 | ![]() |
Amygdala | 13.45 | ![]() |
Appendix | 51.6 | ![]() |
AtrioventricularNode | 32 | ![]() |
BDCA4+_DentriticCells | 3450 | ![]() |
Bonemarrow | 51.75 | ![]() |
BronchialEpithelialCells | 2381.2 | ![]() |
CD105+_Endothelial | 107.45 | ![]() |
CD14+_Monocytes | 3860.35 | ![]() |
CD19+_BCells(neg._sel.) | 21.65 | ![]() |
CD33+_Myeloid | 2735.35 | ![]() |
CD34+ | 106.7 | ![]() |
CD4+_Tcells | 12.7 | ![]() |
CD56+_NKCells | 240.35 | ![]() |
CD71+_EarlyErythroid | 7.1 | ![]() |
CD8+_Tcells | 8.6 | ![]() |
CardiacMyocytes | 7285.8 | ![]() |
Caudatenucleus | 10.6 | ![]() |
Cerebellum | 8.2 | ![]() |
CerebellumPeduncles | 11.45 | ![]() |
CiliaryGanglion | 117.15 | ![]() |
CingulateCortex | 6.95 | ![]() |
Colorectaladenocarcinoma | 317.6 | ![]() |
DorsalRootGanglion | 45.75 | ![]() |
FetalThyroid | 71.9 | ![]() |
Fetalbrain | 26.15 | ![]() |
Fetalliver | 659.75 | ![]() |
Fetallung | 771.75 | ![]() |
GlobusPallidus | 8.75 | ![]() |
Heart | 187.5 | ![]() |
Hypothalamus | 21.1 | ![]() |
Kidney | 28.1 | ![]() |
Leukemia_chronicMyelogenousK-562 | 10.7 | ![]() |
Leukemia_promyelocytic-HL-60 | 6.05 | ![]() |
Leukemialymphoblastic(MOLT-4) | 9.6 | ![]() |
Liver | 255.1 | ![]() |
Lung | 535.4 | ![]() |
Lymphnode | 296.8 | ![]() |
Lymphoma_burkitts(Daudi) | 10.7 | ![]() |
Lymphoma_burkitts(Raji) | 14.35 | ![]() |
MedullaOblongata | 11.1 | ![]() |
OccipitalLobe | 7.4 | ![]() |
OlfactoryBulb | 188.2 | ![]() |
Ovary | 37.5 | ![]() |
Pancreas | 1351.95 | ![]() |
PancreaticIslet | 146.3 | ![]() |
ParietalLobe | 10.6 | ![]() |
Pituitary | 105.65 | ![]() |
Placenta | 1009.8 | ![]() |
Pons | 11.2 | ![]() |
PrefrontalCortex | 10.55 | ![]() |
Prostate | 196.95 | ![]() |
Salivarygland | 23.75 | ![]() |
SkeletalMuscle | 15.4 | ![]() |
Skin | 220.45 | ![]() |
SmoothMuscle | 8011.9 | ![]() |
Spinalcord | 41.1 | ![]() |
SubthalamicNucleus | 10.2 | ![]() |
SuperiorCervicalGanglion | 15 | ![]() |
TemporalLobe | 10.2 | ![]() |
Testis | 16.15 | ![]() |
TestisGermCell | 157.5 | ![]() |
TestisIntersitial | 16.35 | ![]() |
TestisLeydigCell | 31.35 | ![]() |
TestisSeminiferousTubule | 10.9 | ![]() |
Thalamus | 10.7 | ![]() |
Thymus | 406.4 | ![]() |
Thyroid | 69.1 | ![]() |
Tongue | 86 | ![]() |
Tonsil | 109.25 | ![]() |
Trachea | 180.1 | ![]() |
TrigeminalGanglion | 70.95 | ![]() |
Uterus | 235 | ![]() |
UterusCorpus | 1573.8 | ![]() |
WholeBlood | 845.75 | ![]() |
Wholebrain | 10.35 | ![]() |
colon | 46.05 | ![]() |
pineal_day | 1230.86 | ![]() |
pineal_night | 1756.82 | ![]() |
retina | 134.075 | ![]() |
small_intestine | 431.6 | ![]() |
- Probe name: A_24_P610405
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 2.1 ± 1.01 | ![]() ![]() ![]() |
Basal Forebrain | 1.66 ± 0.2 | ![]() ![]() ![]() |
Basal Part of Pons | 1.34 ± 0.35 | ![]() ![]() ![]() |
Cerebellar Cortex | 1.46 ± 0.71 | ![]() ![]() ![]() |
Cerebellar Nuclei | 1.93 ± 0.73 | ![]() ![]() ![]() |
Claustrum | 2.47 ± 0.78 | ![]() ![]() ![]() |
Epithalamus | 1.38 ± 0.76 | ![]() ![]() ![]() |
Frontal Lobe | 1.59 ± 0.9 | ![]() ![]() ![]() |
Globus Pallidus | 2.28 ± 0.39 | ![]() ![]() ![]() |
Hypothalamus | 1.72 ± 0.71 | ![]() ![]() ![]() |
Insula | 1.51 ± 0.42 | ![]() ![]() ![]() |
Limbic Lobe | 1.65 ± 0.6 | ![]() ![]() ![]() |
Mesencephalon | 1.8 ± 0.69 | ![]() ![]() ![]() |
Myelencephalon | 1.67 ± 0.66 | ![]() ![]() ![]() |
Occipital Lobe | 1.61 ± 0.43 | ![]() ![]() ![]() |
Parietal Lobe | 1.62 ± 0.55 | ![]() ![]() ![]() |
Pontine Tegmentum | 1.7 ± 0.68 | ![]() ![]() ![]() |
Striatum | 1.83 ± 0.54 | ![]() ![]() ![]() |
Subthalamus | 1.8 ± 0.64 | ![]() ![]() ![]() |
Temporal Lobe | 1.5 ± 0.51 | ![]() ![]() ![]() |
Thalamus | 1.62 ± 0.57 | ![]() ![]() ![]() |
White Matter | 2.29 ± 0.42 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Tgfbi | CB | Cerebellum | 2.43 | ![]() |
3.2 | ![]() | |||
Tgfbi | CTX | Cerebral cortex | 2.14 | ![]() |
2.01 | ![]() | |||
Tgfbi | HIP | Hippocampal region | 3.13 | ![]() |
3.58 | ![]() | |||
Tgfbi | HPF | Hippocampal formation | 4.54 | ![]() |
4.39 | ![]() | |||
Tgfbi | HY | Hypothalamus | 1.05 | ![]() |
0.86 | ![]() | |||
Tgfbi | LSX | Lateral septal complex | 2.67 | ![]() |
5.07 | ![]() | |||
Tgfbi | MB | Midbrain | 1.76 | ![]() |
2.14 | ![]() | |||
Tgfbi | MY | Medulla | 3.64 | ![]() |
6.86 | ![]() | |||
Tgfbi | OLF | Olfactory bulb | 3.18 | ![]() |
2.21 | ![]() | |||
Tgfbi | P | Pons | 2.08 | ![]() |
2.7 | ![]() | |||
Tgfbi | PAL | Pallidum | 1.97 | ![]() |
1.91 | ![]() | |||
Tgfbi | RHP | Retrohippocampal region | 6.51 | ![]() |
5.03 | ![]() | |||
Tgfbi | sAMY | Striatum-like amygdalar nuclei | 1.1 | ![]() |
1.92 | ![]() | |||
Tgfbi | STR | Striatum | 1.22 | ![]() |
1.61 | ![]() | |||
Tgfbi | STRd | Striatum dorsal region | 1.05 | ![]() |
1.31 | ![]() | |||
Tgfbi | STRv | Striatum ventral region | 0.81 | ![]() |
0.48 | ![]() | |||
Tgfbi | TH | Thalamus | 1.54 | ![]() |
1.63 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
BGH3_HUMAN_258 | 30 | 258 | 287 | AAVAASGLNTMLEGNGQYTLLAPTNEAFEK | PRIDE |
BGH3_HUMAN_488 | 9 | 488 | 496 | YGTLFTMDR | PRIDE |
BGH3_HUMAN_515 | 19 | 515 | 533 | FSMLVAAIQSAGLTETLNR | PRIDE |
BGH3_HUMAN_96 | 29 | 96 | 124 | GCPAALPLSNLYETLGVVGSTTTQLYTDR | PRIDE |
PAp00091776 | 15 | 220 | 234 | ADHHATNGVVHLIDK | Peptide Atlas |