Annotation Detail for TLR4


Gene Symbol: | TLR4 ( ARMD10,CD284,TOLL,hToll ) |
---|---|
Gene Full Name: | toll-like receptor 4 |
Band: | 9q33.1 |
Quick Links | Entrez ID:7099; OMIM: 603030; Uniprot ID:TLR4_HUMAN; ENSEMBL ID: ENSG00000136869; HGNC ID: 11850 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.174312
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 2 / 70761 | 28 | ![]() |
blastocyst | 1 / 62319 | 16 | ![]() |
fetus | 7 / 564012 | 12 | ![]() |
neonate | 2 / 31097 | 64 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 23 / 1939121 | 11 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 3 / 82823 | 36 | ![]() |
colorectal tumor | 1 / 114246 | 8 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 1 / 119369 | 8 | ![]() |
germ cell tumor | 1 / 263845 | 3 | ![]() |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 2 / 68959 | 29 | ![]() |
leukemia | 2 / 95842 | 20 | ![]() |
liver tumor | 2 / 96359 | 20 | ![]() |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 6 / 97250 | 61 | ![]() |
normal | 81 / 3360307 | 24 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 1 / 124949 | 8 | ![]() |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 8 / 123478 | 64 | ![]() |
bone | 1 / 71655 | 13 | ![]() |
bone marrow | 4 / 48801 | 81 | ![]() |
brain | 26 / 1100989 | 23 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 7 / 149255 | 46 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 4 / 215722 | 18 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 5 / 211054 | 23 | ![]() |
heart | 0 / 89626 | 0 | |
intestine | 2 / 234472 | 8 | ![]() |
kidney | 9 / 211777 | 42 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 6 / 207743 | 28 | ![]() |
lung | 5 / 336974 | 14 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 2 / 153271 | 13 | ![]() |
mouth | 1 / 67052 | 14 | ![]() |
muscle | 4 / 107715 | 37 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 6 / 280825 | 21 | ![]() |
prostate | 1 / 189345 | 5 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 3 / 210574 | 14 | ![]() |
spleen | 2 / 53952 | 37 | ![]() |
stomach | 1 / 96619 | 10 | ![]() |
testis | 3 / 330442 | 9 | ![]() |
thymus | 1 / 81131 | 12 | ![]() |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 8 / 52413 | 152 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 4 / 232878 | 17 | ![]() |
vascular | 3 / 51780 | 57 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 221060_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 6.4 | ![]() |
Adipocyte | 4.95 | ![]() |
AdrenalCortex | 5.5 | ![]() |
Adrenalgland | 4.3 | ![]() |
Amygdala | 5.25 | ![]() |
Appendix | 5.5 | ![]() |
AtrioventricularNode | 4.1 | ![]() |
BDCA4+_DentriticCells | 5.75 | ![]() |
Bonemarrow | 5.3 | ![]() |
BronchialEpithelialCells | 5.05 | ![]() |
CD105+_Endothelial | 5.25 | ![]() |
CD14+_Monocytes | 45.1 | ![]() |
CD19+_BCells(neg._sel.) | 5.45 | ![]() |
CD33+_Myeloid | 197.25 | ![]() |
CD34+ | 6.55 | ![]() |
CD4+_Tcells | 5.45 | ![]() |
CD56+_NKCells | 6.15 | ![]() |
CD71+_EarlyErythroid | 4.75 | ![]() |
CD8+_Tcells | 4.75 | ![]() |
CardiacMyocytes | 6.55 | ![]() |
Caudatenucleus | 4.55 | ![]() |
Cerebellum | 4.1 | ![]() |
CerebellumPeduncles | 5.85 | ![]() |
CiliaryGanglion | 4.15 | ![]() |
CingulateCortex | 5.25 | ![]() |
Colorectaladenocarcinoma | 5.05 | ![]() |
DorsalRootGanglion | 4.15 | ![]() |
FetalThyroid | 4.95 | ![]() |
Fetalbrain | 5.1 | ![]() |
Fetalliver | 4.5 | ![]() |
Fetallung | 4.25 | ![]() |
GlobusPallidus | 3.85 | ![]() |
Heart | 6.6 | ![]() |
Hypothalamus | 5.6 | ![]() |
Kidney | 4.35 | ![]() |
Leukemia_chronicMyelogenousK-562 | 4.6 | ![]() |
Leukemia_promyelocytic-HL-60 | 4.45 | ![]() |
Leukemialymphoblastic(MOLT-4) | 4.05 | ![]() |
Liver | 6.7 | ![]() |
Lung | 5.55 | ![]() |
Lymphnode | 4.4 | ![]() |
Lymphoma_burkitts(Daudi) | 6.5 | ![]() |
Lymphoma_burkitts(Raji) | 7.1 | ![]() |
MedullaOblongata | 4.7 | ![]() |
OccipitalLobe | 4.55 | ![]() |
OlfactoryBulb | 4.05 | ![]() |
Ovary | 3.55 | ![]() |
Pancreas | 4.05 | ![]() |
PancreaticIslet | 5.4 | ![]() |
ParietalLobe | 5.45 | ![]() |
Pituitary | 5.95 | ![]() |
Placenta | 5.35 | ![]() |
Pons | 4.85 | ![]() |
PrefrontalCortex | 6.45 | ![]() |
Prostate | 5.9 | ![]() |
Salivarygland | 4.15 | ![]() |
SkeletalMuscle | 6.8 | ![]() |
Skin | 4.2 | ![]() |
SmoothMuscle | 5.95 | ![]() |
Spinalcord | 5.45 | ![]() |
SubthalamicNucleus | 4.65 | ![]() |
SuperiorCervicalGanglion | 6.35 | ![]() |
TemporalLobe | 4.7 | ![]() |
Testis | 4.4 | ![]() |
TestisGermCell | 4.25 | ![]() |
TestisIntersitial | 4.4 | ![]() |
TestisLeydigCell | 5.1 | ![]() |
TestisSeminiferousTubule | 4.35 | ![]() |
Thalamus | 5.2 | ![]() |
Thymus | 4 | ![]() |
Thyroid | 6.2 | ![]() |
Tongue | 5.15 | ![]() |
Tonsil | 5 | ![]() |
Trachea | 4.25 | ![]() |
TrigeminalGanglion | 8.35 | ![]() |
Uterus | 4.1 | ![]() |
UterusCorpus | 5.1 | ![]() |
WholeBlood | 71.35 | ![]() |
Wholebrain | 4.2 | ![]() |
colon | 5.15 | ![]() |
pineal_day | 6.9 | ![]() |
pineal_night | 6.28 | ![]() |
retina | 6.225 | ![]() |
small_intestine | 4.9 | ![]() |
- Probe name: A_32_P66881
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.17 ± 0.59 | ![]() ![]() ![]() |
Basal Forebrain | 5.19 ± 0.74 | ![]() ![]() ![]() |
Basal Part of Pons | 4.61 ± 0.87 | ![]() ![]() ![]() |
Cerebellar Cortex | 4.49 ± 0.35 | ![]() ![]() ![]() |
Cerebellar Nuclei | 4.9 ± 0.83 | ![]() ![]() ![]() |
Claustrum | 4.28 ± 1.1 | ![]() ![]() ![]() |
Epithalamus | 5.07 ± 0.54 | ![]() ![]() ![]() |
Frontal Lobe | 5.03 ± 0.56 | ![]() ![]() ![]() |
Globus Pallidus | 6.61 ± 0.41 | ![]() ![]() ![]() |
Hypothalamus | 5.43 ± 0.68 | ![]() ![]() ![]() |
Insula | 5.28 ± 0.4 | ![]() ![]() ![]() |
Limbic Lobe | 4.77 ± 0.72 | ![]() ![]() ![]() |
Mesencephalon | 5.61 ± 0.63 | ![]() ![]() ![]() |
Myelencephalon | 5.25 ± 0.75 | ![]() ![]() ![]() |
Occipital Lobe | 5.53 ± 0.48 | ![]() ![]() ![]() |
Parietal Lobe | 5.17 ± 0.65 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.28 ± 0.59 | ![]() ![]() ![]() |
Striatum | 6.44 ± 0.54 | ![]() ![]() ![]() |
Subthalamus | 5.71 ± 0.44 | ![]() ![]() ![]() |
Temporal Lobe | 5.23 ± 0.47 | ![]() ![]() ![]() |
Thalamus | 5.51 ± 0.59 | ![]() ![]() ![]() |
White Matter | 3.64 ± 0.11 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Tlr4 | CB | Cerebellum | 0.23 | ![]() |
0.62 | ![]() | |||
Tlr4 | CTX | Cerebral cortex | 1.03 | ![]() |
1.03 | ![]() | |||
Tlr4 | HIP | Hippocampal region | 0.26 | ![]() |
0.33 | ![]() | |||
Tlr4 | HPF | Hippocampal formation | 0.24 | ![]() |
0.28 | ![]() | |||
Tlr4 | HY | Hypothalamus | 0.25 | ![]() |
0.33 | ![]() | |||
Tlr4 | LSX | Lateral septal complex | 0.2 | ![]() |
0.15 | ![]() | |||
Tlr4 | MB | Midbrain | 0.52 | ![]() |
0.81 | ![]() | |||
Tlr4 | MY | Medulla | 0.25 | ![]() |
0.3 | ![]() | |||
Tlr4 | OLF | Olfactory bulb | 1.27 | ![]() |
2.38 | ![]() | |||
Tlr4 | P | Pons | 0.4 | ![]() |
0.77 | ![]() | |||
Tlr4 | PAL | Pallidum | 0.04 | ![]() |
0.02 | ![]() | |||
Tlr4 | RHP | Retrohippocampal region | 0.2 | ![]() |
0.21 | ![]() | |||
Tlr4 | sAMY | Striatum-like amygdalar nuclei | 0.36 | ![]() |
0.69 | ![]() | |||
Tlr4 | STR | Striatum | 0.28 | ![]() |
0.7 | ![]() | |||
Tlr4 | STRd | Striatum dorsal region | 0.33 | ![]() |
0.96 | ![]() | |||
Tlr4 | STRv | Striatum ventral region | 0.08 | ![]() |
0.07 | ![]() | |||
Tlr4 | TH | Thalamus | 0.39 | ![]() |
0.37 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
TLR4_HUMAN_561 | 34 | 561 | 594 | QELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIK | PRIDE |