Annotation Detail for TMPO
Basic Information Top
| Gene Symbol: | TMPO ( CMD1T,LAP2,LEMD4,MGC61508,PRO0868,TP ) |
|---|---|
| Gene Full Name: | thymopoietin |
| Band: | 12q23.1 |
| Quick Links | Entrez ID:7112; OMIM: 188380; Uniprot ID:LAP2A_HUMAN; ENSEMBL ID: ENSG00000120802; HGNC ID: 11875 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.11355
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 15 / 70761 | 211 | |
| blastocyst | 13 / 62319 | 208 | |
| fetus | 80 / 564012 | 141 | |
| neonate | 1 / 31097 | 32 | |
| infant | 6 / 23620 | 254 | |
| juvenile | 9 / 55556 | 161 | |
| adult | 134 / 1939121 | 69 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 2 / 17475 | 114 | |
| breast (mammary gland) tumor | 13 / 94178 | 138 | |
| cervical tumor | 5 / 34366 | 145 | |
| chondrosarcoma | 12 / 82823 | 144 | |
| colorectal tumor | 11 / 114246 | 96 | |
| esophageal tumor | 1 / 17290 | 57 | |
| gastrointestinal tumor | 11 / 119369 | 92 | |
| germ cell tumor | 48 / 263845 | 181 | |
| glioma | 17 / 106883 | 159 | |
| head and neck tumor | 6 / 136302 | 44 | |
| kidney tumor | 3 / 68959 | 43 | |
| leukemia | 17 / 95842 | 177 | |
| liver tumor | 12 / 96359 | 124 | |
| lung tumor | 4 / 103127 | 38 | |
| lymphoma | 9 / 71755 | 125 | |
| non-neoplasia | 1 / 97250 | 10 | |
| normal | 296 / 3360307 | 88 | |
| ovarian tumor | 4 / 76682 | 52 | |
| pancreatic tumor | 4 / 104616 | 38 | |
| primitive neuroectodermal tumor of the CNS | 15 / 125680 | 119 | |
| prostate cancer | 4 / 102680 | 38 | |
| retinoblastoma | 9 / 46356 | 194 | |
| skin tumor | 11 / 124949 | 88 | |
| soft tissue/muscle tissue tumor | 12 / 125191 | 95 | |
| uterine tumor | 8 / 90257 | 88 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 1 / 33197 | 30 | |
| ascites | 5 / 40015 | 124 | |
| bladder | 8 / 29757 | 268 | |
| blood | 9 / 123478 | 72 | |
| bone | 14 / 71655 | 195 | |
| bone marrow | 13 / 48801 | 266 | |
| brain | 73 / 1100989 | 66 | |
| cervix | 7 / 48171 | 145 | |
| connective tissue | 6 / 149255 | 40 | |
| ear | 8 / 16212 | 493 | |
| embryonic tissue | 36 / 215722 | 166 | |
| esophagus | 1 / 20209 | 49 | |
| eye | 22 / 211054 | 104 | |
| heart | 7 / 89626 | 78 | |
| intestine | 19 / 234472 | 81 | |
| kidney | 14 / 211777 | 66 | |
| larynx | 0 / 24145 | 0 | |
| liver | 17 / 207743 | 81 | |
| lung | 18 / 336974 | 53 | |
| lymph | 3 / 44270 | 67 | |
| lymph node | 33 / 91610 | 360 | |
| mammary gland | 17 / 153271 | 110 | |
| mouth | 4 / 67052 | 59 | |
| muscle | 4 / 107715 | 37 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 7 / 102051 | 68 | |
| pancreas | 17 / 214812 | 79 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 18 / 280825 | 64 | |
| prostate | 8 / 189345 | 42 | |
| salivary gland | 3 / 20155 | 148 | |
| skin | 14 / 210574 | 66 | |
| spleen | 1 / 53952 | 18 | |
| stomach | 3 / 96619 | 31 | |
| testis | 55 / 330442 | 166 | |
| thymus | 16 / 81131 | 197 | |
| thyroid | 4 / 47473 | 84 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 4 / 52413 | 76 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 23 / 232878 | 98 | |
| vascular | 5 / 51780 | 96 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 209754_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 96.05 | |
| Adipocyte | 7.25 | |
| AdrenalCortex | 8.3 | |
| Adrenalgland | 7 | |
| Amygdala | 8.2 | |
| Appendix | 10.4 | |
| AtrioventricularNode | 6.2 | |
| BDCA4+_DentriticCells | 26.25 | |
| Bonemarrow | 14.85 | |
| BronchialEpithelialCells | 6.9 | |
| CD105+_Endothelial | 47.2 | |
| CD14+_Monocytes | 10.75 | |
| CD19+_BCells(neg._sel.) | 19.35 | |
| CD33+_Myeloid | 24.95 | |
| CD34+ | 92.65 | |
| CD4+_Tcells | 20.5 | |
| CD56+_NKCells | 32.45 | |
| CD71+_EarlyErythroid | 142.1 | |
| CD8+_Tcells | 14.9 | |
| CardiacMyocytes | 10.75 | |
| Caudatenucleus | 6.9 | |
| Cerebellum | 6.35 | |
| CerebellumPeduncles | 9.5 | |
| CiliaryGanglion | 7.6 | |
| CingulateCortex | 8.3 | |
| Colorectaladenocarcinoma | 9.1 | |
| DorsalRootGanglion | 6.55 | |
| FetalThyroid | 7.7 | |
| Fetalbrain | 7.45 | |
| Fetalliver | 37.85 | |
| Fetallung | 5.95 | |
| GlobusPallidus | 6.2 | |
| Heart | 10.4 | |
| Hypothalamus | 7.75 | |
| Kidney | 7.35 | |
| Leukemia_chronicMyelogenousK-562 | 7.15 | |
| Leukemia_promyelocytic-HL-60 | 17.95 | |
| Leukemialymphoblastic(MOLT-4) | 52.55 | |
| Liver | 12.65 | |
| Lung | 8 | |
| Lymphnode | 6.5 | |
| Lymphoma_burkitts(Daudi) | 10.55 | |
| Lymphoma_burkitts(Raji) | 12.25 | |
| MedullaOblongata | 6.65 | |
| OccipitalLobe | 6.5 | |
| OlfactoryBulb | 5.65 | |
| Ovary | 5.2 | |
| Pancreas | 6.35 | |
| PancreaticIslet | 8.25 | |
| ParietalLobe | 8.4 | |
| Pituitary | 9.05 | |
| Placenta | 6.9 | |
| Pons | 8.3 | |
| PrefrontalCortex | 8.75 | |
| Prostate | 8.7 | |
| Salivarygland | 6.7 | |
| SkeletalMuscle | 16.3 | |
| Skin | 6.95 | |
| SmoothMuscle | 8.35 | |
| Spinalcord | 7.6 | |
| SubthalamicNucleus | 7.25 | |
| SuperiorCervicalGanglion | 13.55 | |
| TemporalLobe | 7.45 | |
| Testis | 6.2 | |
| TestisGermCell | 5.5 | |
| TestisIntersitial | 6.6 | |
| TestisLeydigCell | 8.1 | |
| TestisSeminiferousTubule | 6.5 | |
| Thalamus | 7.9 | |
| Thymus | 36.15 | |
| Thyroid | 8.2 | |
| Tongue | 9.3 | |
| Tonsil | 8.15 | |
| Trachea | 5.95 | |
| TrigeminalGanglion | 8.9 | |
| Uterus | 6.1 | |
| UterusCorpus | 8.35 | |
| WholeBlood | 11.5 | |
| Wholebrain | 5.9 | |
| colon | 48.2 | |
| pineal_day | 9.04 | |
| pineal_night | 9 | |
| retina | 8.55 | |
| small_intestine | 39.85 |
- Probe name: A_23_P325040
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 3.54 ± 0.9 | |
| Basal Forebrain | 3.2 ± 0.41 | |
| Basal Part of Pons | 3 ± 0.44 | |
| Cerebellar Cortex | 4.01 ± 0.37 | |
| Cerebellar Nuclei | 3.8 ± 0.67 | |
| Claustrum | 3.79 ± 0.87 | |
| Epithalamus | 3.84 ± 0.45 | |
| Frontal Lobe | 3.42 ± 0.76 | |
| Globus Pallidus | 3.11 ± 0.58 | |
| Hypothalamus | 3.42 ± 0.29 | |
| Insula | 2.55 ± 0.79 | |
| Limbic Lobe | 3.25 ± 0.71 | |
| Mesencephalon | 3.58 ± 0.66 | |
| Myelencephalon | 3.41 ± 0.62 | |
| Occipital Lobe | 3.77 ± 0.57 | |
| Parietal Lobe | 3.56 ± 0.65 | |
| Pontine Tegmentum | 3.51 ± 0.76 | |
| Striatum | 2.7 ± 0.61 | |
| Subthalamus | 3.47 ± 0.72 | |
| Temporal Lobe | 3.42 ± 0.72 | |
| Thalamus | 3.39 ± 0.64 | |
| White Matter | 4.12 ± 0.45 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| LAP2A_HUMAN_1 | 32 | 1 | 32 | PEFLEDPSVLTKDKLKSELVANNVTLPAGEQR | PRIDE |
| LAP2A_HUMAN_130 | 9 | 130 | 138 | PGPIVGTTR | PRIDE |
| LAP2A_HUMAN_2 | 32 | 2 | 33 | PEFLEDPSVLTKDKLKSELVANNVTLPAGEQR | PRIDE |
| LAP2A_HUMAN_440 | 22 | 440 | 461 | DSGSFVAFQNIPGSELMSSFAK | PRIDE |
| LAP2A_HUMAN_511 | 14 | 511 | 524 | QLPSLACKYPVSSR | PRIDE |
| LAP2B_HUMAN_126 | 13 | 126 | 138 | YGVNPGPIVGTTR | PRIDE |
| LAP2B_HUMAN_269 | 28 | 269 | 296 | IDGPVISESTPIAETIMASSNESLVVNR | PRIDE |
| LAP2B_HUMAN_368 | 13 | 368 | 380 | GAAGRPLELSDFR | PRIDE |
| LAP2B_HUMAN_373 | 8 | 373 | 380 | PLELSDFR | PRIDE |
| PAp00001861 | 14 | 35 | 48 | DVYVQLYLQHLTAR | Peptide Atlas |




Mouse Brain ISH