Annotation Detail for TMPO
Basic Information Top
Gene Symbol: | TMPO ( CMD1T,LAP2,LEMD4,MGC61508,PRO0868,TP ) |
---|---|
Gene Full Name: | thymopoietin |
Band: | 12q23.1 |
Quick Links | Entrez ID:7112; OMIM: 188380; Uniprot ID:LAP2A_HUMAN; ENSEMBL ID: ENSG00000120802; HGNC ID: 11875 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.11355
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 15 / 70761 | 211 | |
blastocyst | 13 / 62319 | 208 | |
fetus | 80 / 564012 | 141 | |
neonate | 1 / 31097 | 32 | |
infant | 6 / 23620 | 254 | |
juvenile | 9 / 55556 | 161 | |
adult | 134 / 1939121 | 69 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 2 / 17475 | 114 | |
breast (mammary gland) tumor | 13 / 94178 | 138 | |
cervical tumor | 5 / 34366 | 145 | |
chondrosarcoma | 12 / 82823 | 144 | |
colorectal tumor | 11 / 114246 | 96 | |
esophageal tumor | 1 / 17290 | 57 | |
gastrointestinal tumor | 11 / 119369 | 92 | |
germ cell tumor | 48 / 263845 | 181 | |
glioma | 17 / 106883 | 159 | |
head and neck tumor | 6 / 136302 | 44 | |
kidney tumor | 3 / 68959 | 43 | |
leukemia | 17 / 95842 | 177 | |
liver tumor | 12 / 96359 | 124 | |
lung tumor | 4 / 103127 | 38 | |
lymphoma | 9 / 71755 | 125 | |
non-neoplasia | 1 / 97250 | 10 | |
normal | 296 / 3360307 | 88 | |
ovarian tumor | 4 / 76682 | 52 | |
pancreatic tumor | 4 / 104616 | 38 | |
primitive neuroectodermal tumor of the CNS | 15 / 125680 | 119 | |
prostate cancer | 4 / 102680 | 38 | |
retinoblastoma | 9 / 46356 | 194 | |
skin tumor | 11 / 124949 | 88 | |
soft tissue/muscle tissue tumor | 12 / 125191 | 95 | |
uterine tumor | 8 / 90257 | 88 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 1 / 33197 | 30 | |
ascites | 5 / 40015 | 124 | |
bladder | 8 / 29757 | 268 | |
blood | 9 / 123478 | 72 | |
bone | 14 / 71655 | 195 | |
bone marrow | 13 / 48801 | 266 | |
brain | 73 / 1100989 | 66 | |
cervix | 7 / 48171 | 145 | |
connective tissue | 6 / 149255 | 40 | |
ear | 8 / 16212 | 493 | |
embryonic tissue | 36 / 215722 | 166 | |
esophagus | 1 / 20209 | 49 | |
eye | 22 / 211054 | 104 | |
heart | 7 / 89626 | 78 | |
intestine | 19 / 234472 | 81 | |
kidney | 14 / 211777 | 66 | |
larynx | 0 / 24145 | 0 | |
liver | 17 / 207743 | 81 | |
lung | 18 / 336974 | 53 | |
lymph | 3 / 44270 | 67 | |
lymph node | 33 / 91610 | 360 | |
mammary gland | 17 / 153271 | 110 | |
mouth | 4 / 67052 | 59 | |
muscle | 4 / 107715 | 37 | |
nerve | 0 / 15768 | 0 | |
ovary | 7 / 102051 | 68 | |
pancreas | 17 / 214812 | 79 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 18 / 280825 | 64 | |
prostate | 8 / 189345 | 42 | |
salivary gland | 3 / 20155 | 148 | |
skin | 14 / 210574 | 66 | |
spleen | 1 / 53952 | 18 | |
stomach | 3 / 96619 | 31 | |
testis | 55 / 330442 | 166 | |
thymus | 16 / 81131 | 197 | |
thyroid | 4 / 47473 | 84 | |
tonsil | 0 / 16999 | 0 | |
trachea | 4 / 52413 | 76 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 23 / 232878 | 98 | |
vascular | 5 / 51780 | 96 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 209754_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 96.05 | |
Adipocyte | 7.25 | |
AdrenalCortex | 8.3 | |
Adrenalgland | 7 | |
Amygdala | 8.2 | |
Appendix | 10.4 | |
AtrioventricularNode | 6.2 | |
BDCA4+_DentriticCells | 26.25 | |
Bonemarrow | 14.85 | |
BronchialEpithelialCells | 6.9 | |
CD105+_Endothelial | 47.2 | |
CD14+_Monocytes | 10.75 | |
CD19+_BCells(neg._sel.) | 19.35 | |
CD33+_Myeloid | 24.95 | |
CD34+ | 92.65 | |
CD4+_Tcells | 20.5 | |
CD56+_NKCells | 32.45 | |
CD71+_EarlyErythroid | 142.1 | |
CD8+_Tcells | 14.9 | |
CardiacMyocytes | 10.75 | |
Caudatenucleus | 6.9 | |
Cerebellum | 6.35 | |
CerebellumPeduncles | 9.5 | |
CiliaryGanglion | 7.6 | |
CingulateCortex | 8.3 | |
Colorectaladenocarcinoma | 9.1 | |
DorsalRootGanglion | 6.55 | |
FetalThyroid | 7.7 | |
Fetalbrain | 7.45 | |
Fetalliver | 37.85 | |
Fetallung | 5.95 | |
GlobusPallidus | 6.2 | |
Heart | 10.4 | |
Hypothalamus | 7.75 | |
Kidney | 7.35 | |
Leukemia_chronicMyelogenousK-562 | 7.15 | |
Leukemia_promyelocytic-HL-60 | 17.95 | |
Leukemialymphoblastic(MOLT-4) | 52.55 | |
Liver | 12.65 | |
Lung | 8 | |
Lymphnode | 6.5 | |
Lymphoma_burkitts(Daudi) | 10.55 | |
Lymphoma_burkitts(Raji) | 12.25 | |
MedullaOblongata | 6.65 | |
OccipitalLobe | 6.5 | |
OlfactoryBulb | 5.65 | |
Ovary | 5.2 | |
Pancreas | 6.35 | |
PancreaticIslet | 8.25 | |
ParietalLobe | 8.4 | |
Pituitary | 9.05 | |
Placenta | 6.9 | |
Pons | 8.3 | |
PrefrontalCortex | 8.75 | |
Prostate | 8.7 | |
Salivarygland | 6.7 | |
SkeletalMuscle | 16.3 | |
Skin | 6.95 | |
SmoothMuscle | 8.35 | |
Spinalcord | 7.6 | |
SubthalamicNucleus | 7.25 | |
SuperiorCervicalGanglion | 13.55 | |
TemporalLobe | 7.45 | |
Testis | 6.2 | |
TestisGermCell | 5.5 | |
TestisIntersitial | 6.6 | |
TestisLeydigCell | 8.1 | |
TestisSeminiferousTubule | 6.5 | |
Thalamus | 7.9 | |
Thymus | 36.15 | |
Thyroid | 8.2 | |
Tongue | 9.3 | |
Tonsil | 8.15 | |
Trachea | 5.95 | |
TrigeminalGanglion | 8.9 | |
Uterus | 6.1 | |
UterusCorpus | 8.35 | |
WholeBlood | 11.5 | |
Wholebrain | 5.9 | |
colon | 48.2 | |
pineal_day | 9.04 | |
pineal_night | 9 | |
retina | 8.55 | |
small_intestine | 39.85 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_23_P325040
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.54 ± 0.9 | |
Basal Forebrain | 3.2 ± 0.41 | |
Basal Part of Pons | 3 ± 0.44 | |
Cerebellar Cortex | 4.01 ± 0.37 | |
Cerebellar Nuclei | 3.8 ± 0.67 | |
Claustrum | 3.79 ± 0.87 | |
Epithalamus | 3.84 ± 0.45 | |
Frontal Lobe | 3.42 ± 0.76 | |
Globus Pallidus | 3.11 ± 0.58 | |
Hypothalamus | 3.42 ± 0.29 | |
Insula | 2.55 ± 0.79 | |
Limbic Lobe | 3.25 ± 0.71 | |
Mesencephalon | 3.58 ± 0.66 | |
Myelencephalon | 3.41 ± 0.62 | |
Occipital Lobe | 3.77 ± 0.57 | |
Parietal Lobe | 3.56 ± 0.65 | |
Pontine Tegmentum | 3.51 ± 0.76 | |
Striatum | 2.7 ± 0.61 | |
Subthalamus | 3.47 ± 0.72 | |
Temporal Lobe | 3.42 ± 0.72 | |
Thalamus | 3.39 ± 0.64 | |
White Matter | 4.12 ± 0.45 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
LAP2A_HUMAN_1 | 32 | 1 | 32 | PEFLEDPSVLTKDKLKSELVANNVTLPAGEQR | PRIDE |
LAP2A_HUMAN_130 | 9 | 130 | 138 | PGPIVGTTR | PRIDE |
LAP2A_HUMAN_2 | 32 | 2 | 33 | PEFLEDPSVLTKDKLKSELVANNVTLPAGEQR | PRIDE |
LAP2A_HUMAN_440 | 22 | 440 | 461 | DSGSFVAFQNIPGSELMSSFAK | PRIDE |
LAP2A_HUMAN_511 | 14 | 511 | 524 | QLPSLACKYPVSSR | PRIDE |
LAP2B_HUMAN_126 | 13 | 126 | 138 | YGVNPGPIVGTTR | PRIDE |
LAP2B_HUMAN_269 | 28 | 269 | 296 | IDGPVISESTPIAETIMASSNESLVVNR | PRIDE |
LAP2B_HUMAN_368 | 13 | 368 | 380 | GAAGRPLELSDFR | PRIDE |
LAP2B_HUMAN_373 | 8 | 373 | 380 | PLELSDFR | PRIDE |
PAp00001861 | 14 | 35 | 48 | DVYVQLYLQHLTAR | Peptide Atlas |