Annotation Detail for UBE2L3
Basic Information Top
| Gene Symbol: | UBE2L3 ( E2-F1,L-UBC,UBCH7,UbcM4 ) |
|---|---|
| Gene Full Name: | ubiquitin-conjugating enzyme E2L 3 |
| Band: | 22q11.21 |
| Quick Links | Entrez ID:7332; OMIM: 603721; Uniprot ID:UB2L3_HUMAN; ENSEMBL ID: ENSG00000185651; HGNC ID: 12488 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.108104
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 8 / 70761 | 113 | |
| blastocyst | 3 / 62319 | 48 | |
| fetus | 161 / 564012 | 285 | |
| neonate | 13 / 31097 | 418 | |
| infant | 5 / 23620 | 211 | |
| juvenile | 28 / 55556 | 503 | |
| adult | 412 / 1939121 | 212 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 7 / 12794 | 547 | |
| bladder carcinoma | 2 / 17475 | 114 | |
| breast (mammary gland) tumor | 8 / 94178 | 84 | |
| cervical tumor | 7 / 34366 | 203 | |
| chondrosarcoma | 20 / 82823 | 241 | |
| colorectal tumor | 11 / 114246 | 96 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 17 / 119369 | 142 | |
| germ cell tumor | 64 / 263845 | 242 | |
| glioma | 26 / 106883 | 243 | |
| head and neck tumor | 20 / 136302 | 146 | |
| kidney tumor | 21 / 68959 | 304 | |
| leukemia | 40 / 95842 | 417 | |
| liver tumor | 18 / 96359 | 186 | |
| lung tumor | 11 / 103127 | 106 | |
| lymphoma | 17 / 71755 | 236 | |
| non-neoplasia | 13 / 97250 | 133 | |
| normal | 768 / 3360307 | 228 | |
| ovarian tumor | 16 / 76682 | 208 | |
| pancreatic tumor | 20 / 104616 | 191 | |
| primitive neuroectodermal tumor of the CNS | 48 / 125680 | 381 | |
| prostate cancer | 16 / 102680 | 155 | |
| retinoblastoma | 9 / 46356 | 194 | |
| skin tumor | 33 / 124949 | 264 | |
| soft tissue/muscle tissue tumor | 11 / 125191 | 87 | |
| uterine tumor | 14 / 90257 | 155 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 12 / 33197 | 361 | |
| ascites | 8 / 40015 | 199 | |
| bladder | 3 / 29757 | 100 | |
| blood | 39 / 123478 | 315 | |
| bone | 16 / 71655 | 223 | |
| bone marrow | 15 / 48801 | 307 | |
| brain | 312 / 1100989 | 283 | |
| cervix | 14 / 48171 | 290 | |
| connective tissue | 25 / 149255 | 167 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 27 / 215722 | 125 | |
| esophagus | 2 / 20209 | 98 | |
| eye | 33 / 211054 | 156 | |
| heart | 22 / 89626 | 245 | |
| intestine | 35 / 234472 | 149 | |
| kidney | 45 / 211777 | 212 | |
| larynx | 1 / 24145 | 41 | |
| liver | 28 / 207743 | 134 | |
| lung | 56 / 336974 | 166 | |
| lymph | 2 / 44270 | 45 | |
| lymph node | 18 / 91610 | 196 | |
| mammary gland | 15 / 153271 | 97 | |
| mouth | 4 / 67052 | 59 | |
| muscle | 5 / 107715 | 46 | |
| nerve | 2 / 15768 | 126 | |
| ovary | 16 / 102051 | 156 | |
| pancreas | 33 / 214812 | 153 | |
| parathyroid | 15 / 20539 | 730 | |
| pharynx | 11 / 41328 | 266 | |
| pituitary gland | 5 / 16585 | 301 | |
| placenta | 92 / 280825 | 327 | |
| prostate | 41 / 189345 | 216 | |
| salivary gland | 6 / 20155 | 297 | |
| skin | 61 / 210574 | 289 | |
| spleen | 12 / 53952 | 222 | |
| stomach | 12 / 96619 | 124 | |
| testis | 69 / 330442 | 208 | |
| thymus | 25 / 81131 | 308 | |
| thyroid | 15 / 47473 | 315 | |
| tonsil | 1 / 16999 | 58 | |
| trachea | 3 / 52413 | 57 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 62 / 232878 | 266 | |
| vascular | 15 / 51780 | 289 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 200682_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 1553.7 | |
| Adipocyte | 230.5 | |
| AdrenalCortex | 63.3 | |
| Adrenalgland | 209.5 | |
| Amygdala | 146 | |
| Appendix | 42.05 | |
| AtrioventricularNode | 8.3 | |
| BDCA4+_DentriticCells | 818.15 | |
| Bonemarrow | 263.95 | |
| BronchialEpithelialCells | 958.25 | |
| CD105+_Endothelial | 564.95 | |
| CD14+_Monocytes | 579.35 | |
| CD19+_BCells(neg._sel.) | 441 | |
| CD33+_Myeloid | 444.9 | |
| CD34+ | 538.45 | |
| CD4+_Tcells | 502.85 | |
| CD56+_NKCells | 607.6 | |
| CD71+_EarlyErythroid | 578.2 | |
| CD8+_Tcells | 385.55 | |
| CardiacMyocytes | 439.9 | |
| Caudatenucleus | 55.45 | |
| Cerebellum | 188.6 | |
| CerebellumPeduncles | 105.7 | |
| CiliaryGanglion | 19.85 | |
| CingulateCortex | 71.75 | |
| Colorectaladenocarcinoma | 213.65 | |
| DorsalRootGanglion | 12.7 | |
| FetalThyroid | 141.3 | |
| Fetalbrain | 42.2 | |
| Fetalliver | 213.1 | |
| Fetallung | 131.1 | |
| GlobusPallidus | 60.15 | |
| Heart | 345.55 | |
| Hypothalamus | 170.95 | |
| Kidney | 132.9 | |
| Leukemia_chronicMyelogenousK-562 | 1099.15 | |
| Leukemia_promyelocytic-HL-60 | 372.05 | |
| Leukemialymphoblastic(MOLT-4) | 324.2 | |
| Liver | 211.3 | |
| Lung | 256.35 | |
| Lymphnode | 94.85 | |
| Lymphoma_burkitts(Daudi) | 461.4 | |
| Lymphoma_burkitts(Raji) | 112.95 | |
| MedullaOblongata | 161.45 | |
| OccipitalLobe | 131.75 | |
| OlfactoryBulb | 75.05 | |
| Ovary | 28.25 | |
| Pancreas | 46.1 | |
| PancreaticIslet | 154.25 | |
| ParietalLobe | 145.2 | |
| Pituitary | 303.1 | |
| Placenta | 389.15 | |
| Pons | 70.1 | |
| PrefrontalCortex | 217.65 | |
| Prostate | 243.45 | |
| Salivarygland | 60.55 | |
| SkeletalMuscle | 15.1 | |
| Skin | 7.55 | |
| SmoothMuscle | 703 | |
| Spinalcord | 148.05 | |
| SubthalamicNucleus | 90.6 | |
| SuperiorCervicalGanglion | 15.3 | |
| TemporalLobe | 148.35 | |
| Testis | 461.05 | |
| TestisGermCell | 281.35 | |
| TestisIntersitial | 432 | |
| TestisLeydigCell | 188.55 | |
| TestisSeminiferousTubule | 201 | |
| Thalamus | 73.9 | |
| Thymus | 373.8 | |
| Thyroid | 124.75 | |
| Tongue | 80.6 | |
| Tonsil | 205.2 | |
| Trachea | 176 | |
| TrigeminalGanglion | 49 | |
| Uterus | 118.35 | |
| UterusCorpus | 76.6 | |
| WholeBlood | 406.85 | |
| Wholebrain | 282.85 | |
| colon | 423.4 | |
| pineal_day | 152.08 | |
| pineal_night | 161.22 | |
| retina | 255.7 | |
| small_intestine | 385.15 |
- Probe name: A_32_P91250
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 9.54 ± 0.24 | |
| Basal Forebrain | 9.2 ± 0.13 | |
| Basal Part of Pons | 9.51 ± 0.17 | |
| Cerebellar Cortex | 9.1 ± 0.2 | |
| Cerebellar Nuclei | 9.64 ± 0.23 | |
| Claustrum | 9.29 ± 0.34 | |
| Epithalamus | 9.26 ± 0.33 | |
| Frontal Lobe | 9.32 ± 0.27 | |
| Globus Pallidus | 9.51 ± 0.26 | |
| Hypothalamus | 9.44 ± 0.22 | |
| Insula | 9.25 ± 0.2 | |
| Limbic Lobe | 9.32 ± 0.3 | |
| Mesencephalon | 9.31 ± 0.3 | |
| Myelencephalon | 9.28 ± 0.3 | |
| Occipital Lobe | 9.34 ± 0.27 | |
| Parietal Lobe | 9.34 ± 0.27 | |
| Pontine Tegmentum | 9.34 ± 0.22 | |
| Striatum | 9.13 ± 0.31 | |
| Subthalamus | 9.44 ± 0.17 | |
| Temporal Lobe | 9.35 ± 0.23 | |
| Thalamus | 9.29 ± 0.22 | |
| White Matter | 9.8 ± 0.13 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Ube2l3 | CB | Cerebellum | 100 | |
| 100 | ||||
| Ube2l3 | CTX | Cerebral cortex | 100 | |
| 100 | ||||
| Ube2l3 | HIP | Hippocampal region | 100 | |
| 100 | ||||
| Ube2l3 | HPF | Hippocampal formation | 100 | |
| 100 | ||||
| Ube2l3 | HY | Hypothalamus | 100 | |
| 100 | ||||
| Ube2l3 | LSX | Lateral septal complex | 100 | |
| 100 | ||||
| Ube2l3 | MB | Midbrain | 100 | |
| 100 | ||||
| Ube2l3 | MY | Medulla | 92.68 | |
| 100 | ||||
| Ube2l3 | OLF | Olfactory bulb | 100 | |
| 100 | ||||
| Ube2l3 | P | Pons | 86.11 | |
| 100 | ||||
| Ube2l3 | PAL | Pallidum | 94.92 | |
| 100 | ||||
| Ube2l3 | RHP | Retrohippocampal region | 100 | |
| 100 | ||||
| Ube2l3 | sAMY | Striatum-like amygdalar nuclei | 100 | |
| 100 | ||||
| Ube2l3 | STR | Striatum | 100 | |
| 95.7 | ||||
| Ube2l3 | STRd | Striatum dorsal region | 96.71 | |
| 86.82 | ||||
| Ube2l3 | STRv | Striatum ventral region | 100 | |
| 95.99 | ||||
| Ube2l3 | TH | Thalamus | 100 | |
| 100 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00003076 | 18 | 83 | 100 | GQVCLPVISAENWKPATK | Peptide Atlas |
| UB2L3_HUMAN_0 | 0 | 0 | 0 | IEINFPAEYPFKPPK | PRIDE |
| UB2L3_HUMAN_100 | 22 | 100 | 121 | TDQVIQSLIALVNDPQPEHPLR | PRIDE |
| UB2L3_HUMAN_100 | 31 | 100 | 130 | TDQVIQSLIALVNDPQPEHPLRADLAEEYSK | PRIDE |
| UB2L3_HUMAN_100 | 33 | 100 | 132 | TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDR | PRIDE |
| UB2L3_HUMAN_122 | 11 | 122 | 132 | ADLAEEYSKDR | PRIDE |
| UB2L3_HUMAN_123 | 11 | 123 | 133 | ADLAEEYSKDR | PRIDE |
| UB2L3_HUMAN_23 | 25 | 23 | 47 | NIQVDEANLLTWQGLIVPDNPPYDK | PRIDE |
| UB2L3_HUMAN_52 | 15 | 52 | 66 | IEINFPAEYPFKPPK | PRIDE |
| UB2L3_HUMAN_52 | 19 | 52 | 70 | IEINFPAEYPFKPPKITFK | PRIDE |
| UB2L3_HUMAN_71 | 11 | 71 | 81 | TKIYHPNIDEK | PRIDE |
| UB2L3_HUMAN_73 | 27 | 73 | 99 | IYHPNIDEKGQVCLPVISAENWKPATK | PRIDE |
| UB2L3_HUMAN_73 | 9 | 73 | 81 | IYHPNIDEK | PRIDE |
| UB2L3_HUMAN_82 | 18 | 82 | 99 | GQVCLPVISAENWKPATK | PRIDE |
| UB2L3_HUMAN_97 | 26 | 97 | 122 | PATKTDQVIQSLIALVNDPQPEHPLR | PRIDE |



