Annotation Detail for UBTF
Basic Information Top
| Gene Symbol: | UBTF ( NOR-90,UBF ) |
|---|---|
| Gene Full Name: | upstream binding transcription factor, RNA polymerase I |
| Band: | 17q21.31 |
| Quick Links | Entrez ID:7343; OMIM: 600673; Uniprot ID:UBF1_HUMAN; ENSEMBL ID: ENSG00000108312; HGNC ID: 12511 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.89781
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 7 / 70761 | 98 | |
| blastocyst | 5 / 62319 | 80 | |
| fetus | 59 / 564012 | 104 | |
| neonate | 1 / 31097 | 32 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 6 / 55556 | 107 | |
| adult | 145 / 1939121 | 74 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 9 / 94178 | 95 | |
| cervical tumor | 4 / 34366 | 116 | |
| chondrosarcoma | 10 / 82823 | 120 | |
| colorectal tumor | 9 / 114246 | 78 | |
| esophageal tumor | 2 / 17290 | 115 | |
| gastrointestinal tumor | 11 / 119369 | 92 | |
| germ cell tumor | 19 / 263845 | 72 | |
| glioma | 11 / 106883 | 102 | |
| head and neck tumor | 22 / 136302 | 161 | |
| kidney tumor | 5 / 68959 | 72 | |
| leukemia | 11 / 95842 | 114 | |
| liver tumor | 6 / 96359 | 62 | |
| lung tumor | 4 / 103127 | 38 | |
| lymphoma | 6 / 71755 | 83 | |
| non-neoplasia | 5 / 97250 | 51 | |
| normal | 262 / 3360307 | 77 | |
| ovarian tumor | 5 / 76682 | 65 | |
| pancreatic tumor | 2 / 104616 | 19 | |
| primitive neuroectodermal tumor of the CNS | 3 / 125680 | 23 | |
| prostate cancer | 20 / 102680 | 194 | |
| retinoblastoma | 2 / 46356 | 43 | |
| skin tumor | 11 / 124949 | 88 | |
| soft tissue/muscle tissue tumor | 7 / 125191 | 55 | |
| uterine tumor | 4 / 90257 | 44 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 5 / 40015 | 124 | |
| bladder | 1 / 29757 | 33 | |
| blood | 8 / 123478 | 64 | |
| bone | 5 / 71655 | 69 | |
| bone marrow | 2 / 48801 | 40 | |
| brain | 109 / 1100989 | 99 | |
| cervix | 4 / 48171 | 83 | |
| connective tissue | 11 / 149255 | 73 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 25 / 215722 | 115 | |
| esophagus | 3 / 20209 | 148 | |
| eye | 16 / 211054 | 75 | |
| heart | 2 / 89626 | 22 | |
| intestine | 18 / 234472 | 76 | |
| kidney | 13 / 211777 | 61 | |
| larynx | 4 / 24145 | 165 | |
| liver | 10 / 207743 | 48 | |
| lung | 24 / 336974 | 71 | |
| lymph | 6 / 44270 | 135 | |
| lymph node | 6 / 91610 | 65 | |
| mammary gland | 10 / 153271 | 65 | |
| mouth | 13 / 67052 | 193 | |
| muscle | 8 / 107715 | 74 | |
| nerve | 2 / 15768 | 126 | |
| ovary | 8 / 102051 | 78 | |
| pancreas | 5 / 214812 | 23 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 2 / 16585 | 120 | |
| placenta | 13 / 280825 | 46 | |
| prostate | 38 / 189345 | 200 | |
| salivary gland | 3 / 20155 | 148 | |
| skin | 14 / 210574 | 66 | |
| spleen | 4 / 53952 | 74 | |
| stomach | 6 / 96619 | 62 | |
| testis | 17 / 330442 | 51 | |
| thymus | 16 / 81131 | 197 | |
| thyroid | 6 / 47473 | 126 | |
| tonsil | 5 / 16999 | 294 | |
| trachea | 4 / 52413 | 76 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 12 / 232878 | 51 | |
| vascular | 2 / 51780 | 38 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 214881_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 40.05 | |
| Adipocyte | 8.85 | |
| AdrenalCortex | 14.35 | |
| Adrenalgland | 8.25 | |
| Amygdala | 9.4 | |
| Appendix | 11.9 | |
| AtrioventricularNode | 12.25 | |
| BDCA4+_DentriticCells | 22.3 | |
| Bonemarrow | 10.7 | |
| BronchialEpithelialCells | 8.75 | |
| CD105+_Endothelial | 10.05 | |
| CD14+_Monocytes | 10.9 | |
| CD19+_BCells(neg._sel.) | 16.6 | |
| CD33+_Myeloid | 13.5 | |
| CD34+ | 16.05 | |
| CD4+_Tcells | 44.15 | |
| CD56+_NKCells | 23.95 | |
| CD71+_EarlyErythroid | 41.55 | |
| CD8+_Tcells | 46.85 | |
| CardiacMyocytes | 17.8 | |
| Caudatenucleus | 8.2 | |
| Cerebellum | 7.85 | |
| CerebellumPeduncles | 13.8 | |
| CiliaryGanglion | 8.5 | |
| CingulateCortex | 10.8 | |
| Colorectaladenocarcinoma | 9.4 | |
| DorsalRootGanglion | 10.4 | |
| FetalThyroid | 12.5 | |
| Fetalbrain | 8.7 | |
| Fetalliver | 7.15 | |
| Fetallung | 5.65 | |
| GlobusPallidus | 8.05 | |
| Heart | 17.05 | |
| Hypothalamus | 8.4 | |
| Kidney | 8.5 | |
| Leukemia_chronicMyelogenousK-562 | 7.45 | |
| Leukemia_promyelocytic-HL-60 | 8.25 | |
| Leukemialymphoblastic(MOLT-4) | 7.45 | |
| Liver | 13.65 | |
| Lung | 10.1 | |
| Lymphnode | 7.9 | |
| Lymphoma_burkitts(Daudi) | 12.05 | |
| Lymphoma_burkitts(Raji) | 14.65 | |
| MedullaOblongata | 8.15 | |
| OccipitalLobe | 8.4 | |
| OlfactoryBulb | 7.1 | |
| Ovary | 8.65 | |
| Pancreas | 8.8 | |
| PancreaticIslet | 9.55 | |
| ParietalLobe | 10.15 | |
| Pituitary | 10.25 | |
| Placenta | 9.65 | |
| Pons | 9.15 | |
| PrefrontalCortex | 10.85 | |
| Prostate | 10.95 | |
| Salivarygland | 7.7 | |
| SkeletalMuscle | 18.6 | |
| Skin | 11.15 | |
| SmoothMuscle | 10.75 | |
| Spinalcord | 8.85 | |
| SubthalamicNucleus | 10.15 | |
| SuperiorCervicalGanglion | 15.3 | |
| TemporalLobe | 8.9 | |
| Testis | 6.95 | |
| TestisGermCell | 6.95 | |
| TestisIntersitial | 8.2 | |
| TestisLeydigCell | 10.4 | |
| TestisSeminiferousTubule | 7.5 | |
| Thalamus | 9.6 | |
| Thymus | 19.55 | |
| Thyroid | 11.45 | |
| Tongue | 10.6 | |
| Tonsil | 9.3 | |
| Trachea | 6.75 | |
| TrigeminalGanglion | 17.7 | |
| Uterus | 7.7 | |
| UterusCorpus | 9.5 | |
| WholeBlood | 10.35 | |
| Wholebrain | 9.1 | |
| colon | 9.5 | |
| pineal_day | 27.26 | |
| pineal_night | 21.22 | |
| retina | 11 | |
| small_intestine | 8.7 |
- Probe name: A_23_P100779
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 6.13 ± 0.36 | |
| Basal Forebrain | 5.98 ± 0.53 | |
| Basal Part of Pons | 6.07 ± 0.21 | |
| Cerebellar Cortex | 6.33 ± 0.25 | |
| Cerebellar Nuclei | 5.75 ± 0.25 | |
| Claustrum | 6.04 ± 0.48 | |
| Epithalamus | 5.9 ± 0.22 | |
| Frontal Lobe | 5.86 ± 0.38 | |
| Globus Pallidus | 5.7 ± 0.31 | |
| Hypothalamus | 5.48 ± 0.35 | |
| Insula | 5.94 ± 0.44 | |
| Limbic Lobe | 6.14 ± 0.4 | |
| Mesencephalon | 5.84 ± 0.39 | |
| Myelencephalon | 5.93 ± 0.41 | |
| Occipital Lobe | 6.16 ± 0.36 | |
| Parietal Lobe | 5.87 ± 0.36 | |
| Pontine Tegmentum | 5.83 ± 0.47 | |
| Striatum | 5.88 ± 0.38 | |
| Subthalamus | 5.2 ± 0.54 | |
| Temporal Lobe | 6.01 ± 0.38 | |
| Thalamus | 5.8 ± 0.36 | |
| White Matter | 5.99 ± 0.52 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Ubtf | CB | Cerebellum | 100 | |
| 100 | ||||
| Ubtf | CTX | Cerebral cortex | 100 | |
| 100 | ||||
| Ubtf | HIP | Hippocampal region | 100 | |
| 100 | ||||
| Ubtf | HPF | Hippocampal formation | 100 | |
| 100 | ||||
| Ubtf | HY | Hypothalamus | 100 | |
| 100 | ||||
| Ubtf | LSX | Lateral septal complex | 100 | |
| 100 | ||||
| Ubtf | MB | Midbrain | 100 | |
| 100 | ||||
| Ubtf | MY | Medulla | 99.77 | |
| 100 | ||||
| Ubtf | OLF | Olfactory bulb | 100 | |
| 100 | ||||
| Ubtf | P | Pons | 89.09 | |
| 100 | ||||
| Ubtf | PAL | Pallidum | 100 | |
| 100 | ||||
| Ubtf | RHP | Retrohippocampal region | 100 | |
| 100 | ||||
| Ubtf | sAMY | Striatum-like amygdalar nuclei | 100 | |
| 100 | ||||
| Ubtf | STR | Striatum | 100 | |
| 100 | ||||
| Ubtf | STRd | Striatum dorsal region | 100 | |
| 100 | ||||
| Ubtf | STRv | Striatum ventral region | 100 | |
| 100 | ||||
| Ubtf | TH | Thalamus | 100 | |
| 100 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00002360 | 32 | 293 | 324 | FDGRPTKPPPNSYSLYCAELMANMKDVPSTER | Peptide Atlas |
| UBF1_HUMAN_409 | 13 | 409 | 421 | RPVSAMFIFSEEK | PRIDE |
| UBF1_HUMAN_424 | 16 | 424 | 439 | QLQEERPELSESELTR | PRIDE |



