Annotation Detail for UBTF


Gene Symbol: | UBTF ( NOR-90,UBF ) |
---|---|
Gene Full Name: | upstream binding transcription factor, RNA polymerase I |
Band: | 17q21.31 |
Quick Links | Entrez ID:7343; OMIM: 600673; Uniprot ID:UBF1_HUMAN; ENSEMBL ID: ENSG00000108312; HGNC ID: 12511 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.89781
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 7 / 70761 | 98 | ![]() |
blastocyst | 5 / 62319 | 80 | ![]() |
fetus | 59 / 564012 | 104 | ![]() |
neonate | 1 / 31097 | 32 | ![]() |
infant | 1 / 23620 | 42 | ![]() |
juvenile | 6 / 55556 | 107 | ![]() |
adult | 145 / 1939121 | 74 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 9 / 94178 | 95 | ![]() |
cervical tumor | 4 / 34366 | 116 | ![]() |
chondrosarcoma | 10 / 82823 | 120 | ![]() |
colorectal tumor | 9 / 114246 | 78 | ![]() |
esophageal tumor | 2 / 17290 | 115 | ![]() |
gastrointestinal tumor | 11 / 119369 | 92 | ![]() |
germ cell tumor | 19 / 263845 | 72 | ![]() |
glioma | 11 / 106883 | 102 | ![]() |
head and neck tumor | 22 / 136302 | 161 | ![]() |
kidney tumor | 5 / 68959 | 72 | ![]() |
leukemia | 11 / 95842 | 114 | ![]() |
liver tumor | 6 / 96359 | 62 | ![]() |
lung tumor | 4 / 103127 | 38 | ![]() |
lymphoma | 6 / 71755 | 83 | ![]() |
non-neoplasia | 5 / 97250 | 51 | ![]() |
normal | 262 / 3360307 | 77 | ![]() |
ovarian tumor | 5 / 76682 | 65 | ![]() |
pancreatic tumor | 2 / 104616 | 19 | ![]() |
primitive neuroectodermal tumor of the CNS | 3 / 125680 | 23 | ![]() |
prostate cancer | 20 / 102680 | 194 | ![]() |
retinoblastoma | 2 / 46356 | 43 | ![]() |
skin tumor | 11 / 124949 | 88 | ![]() |
soft tissue/muscle tissue tumor | 7 / 125191 | 55 | ![]() |
uterine tumor | 4 / 90257 | 44 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 0 / 33197 | 0 | |
ascites | 5 / 40015 | 124 | ![]() |
bladder | 1 / 29757 | 33 | ![]() |
blood | 8 / 123478 | 64 | ![]() |
bone | 5 / 71655 | 69 | ![]() |
bone marrow | 2 / 48801 | 40 | ![]() |
brain | 109 / 1100989 | 99 | ![]() |
cervix | 4 / 48171 | 83 | ![]() |
connective tissue | 11 / 149255 | 73 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 25 / 215722 | 115 | ![]() |
esophagus | 3 / 20209 | 148 | ![]() |
eye | 16 / 211054 | 75 | ![]() |
heart | 2 / 89626 | 22 | ![]() |
intestine | 18 / 234472 | 76 | ![]() |
kidney | 13 / 211777 | 61 | ![]() |
larynx | 4 / 24145 | 165 | ![]() |
liver | 10 / 207743 | 48 | ![]() |
lung | 24 / 336974 | 71 | ![]() |
lymph | 6 / 44270 | 135 | ![]() |
lymph node | 6 / 91610 | 65 | ![]() |
mammary gland | 10 / 153271 | 65 | ![]() |
mouth | 13 / 67052 | 193 | ![]() |
muscle | 8 / 107715 | 74 | ![]() |
nerve | 2 / 15768 | 126 | ![]() |
ovary | 8 / 102051 | 78 | ![]() |
pancreas | 5 / 214812 | 23 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 2 / 16585 | 120 | ![]() |
placenta | 13 / 280825 | 46 | ![]() |
prostate | 38 / 189345 | 200 | ![]() |
salivary gland | 3 / 20155 | 148 | ![]() |
skin | 14 / 210574 | 66 | ![]() |
spleen | 4 / 53952 | 74 | ![]() |
stomach | 6 / 96619 | 62 | ![]() |
testis | 17 / 330442 | 51 | ![]() |
thymus | 16 / 81131 | 197 | ![]() |
thyroid | 6 / 47473 | 126 | ![]() |
tonsil | 5 / 16999 | 294 | ![]() |
trachea | 4 / 52413 | 76 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 12 / 232878 | 51 | ![]() |
vascular | 2 / 51780 | 38 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 214881_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 40.05 | ![]() |
Adipocyte | 8.85 | ![]() |
AdrenalCortex | 14.35 | ![]() |
Adrenalgland | 8.25 | ![]() |
Amygdala | 9.4 | ![]() |
Appendix | 11.9 | ![]() |
AtrioventricularNode | 12.25 | ![]() |
BDCA4+_DentriticCells | 22.3 | ![]() |
Bonemarrow | 10.7 | ![]() |
BronchialEpithelialCells | 8.75 | ![]() |
CD105+_Endothelial | 10.05 | ![]() |
CD14+_Monocytes | 10.9 | ![]() |
CD19+_BCells(neg._sel.) | 16.6 | ![]() |
CD33+_Myeloid | 13.5 | ![]() |
CD34+ | 16.05 | ![]() |
CD4+_Tcells | 44.15 | ![]() |
CD56+_NKCells | 23.95 | ![]() |
CD71+_EarlyErythroid | 41.55 | ![]() |
CD8+_Tcells | 46.85 | ![]() |
CardiacMyocytes | 17.8 | ![]() |
Caudatenucleus | 8.2 | ![]() |
Cerebellum | 7.85 | ![]() |
CerebellumPeduncles | 13.8 | ![]() |
CiliaryGanglion | 8.5 | ![]() |
CingulateCortex | 10.8 | ![]() |
Colorectaladenocarcinoma | 9.4 | ![]() |
DorsalRootGanglion | 10.4 | ![]() |
FetalThyroid | 12.5 | ![]() |
Fetalbrain | 8.7 | ![]() |
Fetalliver | 7.15 | ![]() |
Fetallung | 5.65 | ![]() |
GlobusPallidus | 8.05 | ![]() |
Heart | 17.05 | ![]() |
Hypothalamus | 8.4 | ![]() |
Kidney | 8.5 | ![]() |
Leukemia_chronicMyelogenousK-562 | 7.45 | ![]() |
Leukemia_promyelocytic-HL-60 | 8.25 | ![]() |
Leukemialymphoblastic(MOLT-4) | 7.45 | ![]() |
Liver | 13.65 | ![]() |
Lung | 10.1 | ![]() |
Lymphnode | 7.9 | ![]() |
Lymphoma_burkitts(Daudi) | 12.05 | ![]() |
Lymphoma_burkitts(Raji) | 14.65 | ![]() |
MedullaOblongata | 8.15 | ![]() |
OccipitalLobe | 8.4 | ![]() |
OlfactoryBulb | 7.1 | ![]() |
Ovary | 8.65 | ![]() |
Pancreas | 8.8 | ![]() |
PancreaticIslet | 9.55 | ![]() |
ParietalLobe | 10.15 | ![]() |
Pituitary | 10.25 | ![]() |
Placenta | 9.65 | ![]() |
Pons | 9.15 | ![]() |
PrefrontalCortex | 10.85 | ![]() |
Prostate | 10.95 | ![]() |
Salivarygland | 7.7 | ![]() |
SkeletalMuscle | 18.6 | ![]() |
Skin | 11.15 | ![]() |
SmoothMuscle | 10.75 | ![]() |
Spinalcord | 8.85 | ![]() |
SubthalamicNucleus | 10.15 | ![]() |
SuperiorCervicalGanglion | 15.3 | ![]() |
TemporalLobe | 8.9 | ![]() |
Testis | 6.95 | ![]() |
TestisGermCell | 6.95 | ![]() |
TestisIntersitial | 8.2 | ![]() |
TestisLeydigCell | 10.4 | ![]() |
TestisSeminiferousTubule | 7.5 | ![]() |
Thalamus | 9.6 | ![]() |
Thymus | 19.55 | ![]() |
Thyroid | 11.45 | ![]() |
Tongue | 10.6 | ![]() |
Tonsil | 9.3 | ![]() |
Trachea | 6.75 | ![]() |
TrigeminalGanglion | 17.7 | ![]() |
Uterus | 7.7 | ![]() |
UterusCorpus | 9.5 | ![]() |
WholeBlood | 10.35 | ![]() |
Wholebrain | 9.1 | ![]() |
colon | 9.5 | ![]() |
pineal_day | 27.26 | ![]() |
pineal_night | 21.22 | ![]() |
retina | 11 | ![]() |
small_intestine | 8.7 | ![]() |
- Probe name: A_23_P100779
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 6.13 ± 0.36 | ![]() ![]() ![]() |
Basal Forebrain | 5.98 ± 0.53 | ![]() ![]() ![]() |
Basal Part of Pons | 6.07 ± 0.21 | ![]() ![]() ![]() |
Cerebellar Cortex | 6.33 ± 0.25 | ![]() ![]() ![]() |
Cerebellar Nuclei | 5.75 ± 0.25 | ![]() ![]() ![]() |
Claustrum | 6.04 ± 0.48 | ![]() ![]() ![]() |
Epithalamus | 5.9 ± 0.22 | ![]() ![]() ![]() |
Frontal Lobe | 5.86 ± 0.38 | ![]() ![]() ![]() |
Globus Pallidus | 5.7 ± 0.31 | ![]() ![]() ![]() |
Hypothalamus | 5.48 ± 0.35 | ![]() ![]() ![]() |
Insula | 5.94 ± 0.44 | ![]() ![]() ![]() |
Limbic Lobe | 6.14 ± 0.4 | ![]() ![]() ![]() |
Mesencephalon | 5.84 ± 0.39 | ![]() ![]() ![]() |
Myelencephalon | 5.93 ± 0.41 | ![]() ![]() ![]() |
Occipital Lobe | 6.16 ± 0.36 | ![]() ![]() ![]() |
Parietal Lobe | 5.87 ± 0.36 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.83 ± 0.47 | ![]() ![]() ![]() |
Striatum | 5.88 ± 0.38 | ![]() ![]() ![]() |
Subthalamus | 5.2 ± 0.54 | ![]() ![]() ![]() |
Temporal Lobe | 6.01 ± 0.38 | ![]() ![]() ![]() |
Thalamus | 5.8 ± 0.36 | ![]() ![]() ![]() |
White Matter | 5.99 ± 0.52 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Ubtf | CB | Cerebellum | 100 | ![]() |
100 | ![]() | |||
Ubtf | CTX | Cerebral cortex | 100 | ![]() |
100 | ![]() | |||
Ubtf | HIP | Hippocampal region | 100 | ![]() |
100 | ![]() | |||
Ubtf | HPF | Hippocampal formation | 100 | ![]() |
100 | ![]() | |||
Ubtf | HY | Hypothalamus | 100 | ![]() |
100 | ![]() | |||
Ubtf | LSX | Lateral septal complex | 100 | ![]() |
100 | ![]() | |||
Ubtf | MB | Midbrain | 100 | ![]() |
100 | ![]() | |||
Ubtf | MY | Medulla | 99.77 | ![]() |
100 | ![]() | |||
Ubtf | OLF | Olfactory bulb | 100 | ![]() |
100 | ![]() | |||
Ubtf | P | Pons | 89.09 | ![]() |
100 | ![]() | |||
Ubtf | PAL | Pallidum | 100 | ![]() |
100 | ![]() | |||
Ubtf | RHP | Retrohippocampal region | 100 | ![]() |
100 | ![]() | |||
Ubtf | sAMY | Striatum-like amygdalar nuclei | 100 | ![]() |
100 | ![]() | |||
Ubtf | STR | Striatum | 100 | ![]() |
100 | ![]() | |||
Ubtf | STRd | Striatum dorsal region | 100 | ![]() |
100 | ![]() | |||
Ubtf | STRv | Striatum ventral region | 100 | ![]() |
100 | ![]() | |||
Ubtf | TH | Thalamus | 100 | ![]() |
100 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00002360 | 32 | 293 | 324 | FDGRPTKPPPNSYSLYCAELMANMKDVPSTER | Peptide Atlas |
UBF1_HUMAN_409 | 13 | 409 | 421 | RPVSAMFIFSEEK | PRIDE |
UBF1_HUMAN_424 | 16 | 424 | 439 | QLQEERPELSESELTR | PRIDE |