Annotation Detail for VLDLR


Gene Symbol: | VLDLR ( CARMQ1,CHRMQ1,FLJ35024,VLDLRCH ) |
---|---|
Gene Full Name: | very low density lipoprotein receptor |
Band: | 9p24.2 |
Quick Links | Entrez ID:7436; OMIM: 192977; Uniprot ID:VLDLR_HUMAN; ENSEMBL ID: ENSG00000147852; HGNC ID: 12698 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.370422
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 5 / 70761 | 70 | ![]() |
blastocyst | 4 / 62319 | 64 | ![]() |
fetus | 39 / 564012 | 69 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 2 / 55556 | 35 | ![]() |
adult | 53 / 1939121 | 27 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 2 / 82823 | 24 | ![]() |
colorectal tumor | 3 / 114246 | 26 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 1 / 119369 | 8 | ![]() |
germ cell tumor | 26 / 263845 | 98 | ![]() |
glioma | 2 / 106883 | 18 | ![]() |
head and neck tumor | 5 / 136302 | 36 | ![]() |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 1 / 95842 | 10 | ![]() |
liver tumor | 1 / 96359 | 10 | ![]() |
lung tumor | 2 / 103127 | 19 | ![]() |
lymphoma | 1 / 71755 | 13 | ![]() |
non-neoplasia | 3 / 97250 | 30 | ![]() |
normal | 119 / 3360307 | 35 | ![]() |
ovarian tumor | 3 / 76682 | 39 | ![]() |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 6 / 125680 | 47 | ![]() |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 5 / 124949 | 40 | ![]() |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 4 / 90257 | 44 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 2 / 13106 | 152 | ![]() |
adrenal gland | 0 / 33197 | 0 | |
ascites | 1 / 40015 | 24 | ![]() |
bladder | 0 / 29757 | 0 | |
blood | 1 / 123478 | 8 | ![]() |
bone | 3 / 71655 | 41 | ![]() |
bone marrow | 0 / 48801 | 0 | |
brain | 54 / 1100989 | 49 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 2 / 149255 | 13 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 11 / 215722 | 50 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 6 / 211054 | 28 | ![]() |
heart | 7 / 89626 | 78 | ![]() |
intestine | 4 / 234472 | 17 | ![]() |
kidney | 4 / 211777 | 18 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 3 / 207743 | 14 | ![]() |
lung | 10 / 336974 | 29 | ![]() |
lymph | 1 / 44270 | 22 | ![]() |
lymph node | 0 / 91610 | 0 | |
mammary gland | 1 / 153271 | 6 | ![]() |
mouth | 2 / 67052 | 29 | ![]() |
muscle | 2 / 107715 | 18 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 3 / 102051 | 29 | ![]() |
pancreas | 0 / 214812 | 0 | |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 9 / 280825 | 32 | ![]() |
prostate | 0 / 189345 | 0 | |
salivary gland | 0 / 20155 | 0 | |
skin | 5 / 210574 | 23 | ![]() |
spleen | 3 / 53952 | 55 | ![]() |
stomach | 2 / 96619 | 20 | ![]() |
testis | 24 / 330442 | 72 | ![]() |
thymus | 1 / 81131 | 12 | ![]() |
thyroid | 3 / 47473 | 63 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 4 / 52413 | 76 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 11 / 232878 | 47 | ![]() |
vascular | 2 / 51780 | 38 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 209822_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 6.6 | ![]() |
Adipocyte | 5.85 | ![]() |
AdrenalCortex | 7.05 | ![]() |
Adrenalgland | 5.6 | ![]() |
Amygdala | 6.75 | ![]() |
Appendix | 6.85 | ![]() |
AtrioventricularNode | 4.8 | ![]() |
BDCA4+_DentriticCells | 6.45 | ![]() |
Bonemarrow | 5.8 | ![]() |
BronchialEpithelialCells | 18.35 | ![]() |
CD105+_Endothelial | 5.55 | ![]() |
CD14+_Monocytes | 5.8 | ![]() |
CD19+_BCells(neg._sel.) | 6.1 | ![]() |
CD33+_Myeloid | 7.15 | ![]() |
CD34+ | 7.15 | ![]() |
CD4+_Tcells | 5.65 | ![]() |
CD56+_NKCells | 6.25 | ![]() |
CD71+_EarlyErythroid | 5.2 | ![]() |
CD8+_Tcells | 5.15 | ![]() |
CardiacMyocytes | 14.4 | ![]() |
Caudatenucleus | 8.15 | ![]() |
Cerebellum | 4.85 | ![]() |
CerebellumPeduncles | 7.65 | ![]() |
CiliaryGanglion | 4.25 | ![]() |
CingulateCortex | 6.35 | ![]() |
Colorectaladenocarcinoma | 5.7 | ![]() |
DorsalRootGanglion | 5 | ![]() |
FetalThyroid | 6.05 | ![]() |
Fetalbrain | 11.15 | ![]() |
Fetalliver | 5 | ![]() |
Fetallung | 5.1 | ![]() |
GlobusPallidus | 5.2 | ![]() |
Heart | 11 | ![]() |
Hypothalamus | 7.15 | ![]() |
Kidney | 5.3 | ![]() |
Leukemia_chronicMyelogenousK-562 | 5.1 | ![]() |
Leukemia_promyelocytic-HL-60 | 5.1 | ![]() |
Leukemialymphoblastic(MOLT-4) | 8.35 | ![]() |
Liver | 7.7 | ![]() |
Lung | 6.1 | ![]() |
Lymphnode | 4.65 | ![]() |
Lymphoma_burkitts(Daudi) | 7.45 | ![]() |
Lymphoma_burkitts(Raji) | 8.1 | ![]() |
MedullaOblongata | 6.05 | ![]() |
OccipitalLobe | 5.5 | ![]() |
OlfactoryBulb | 5.05 | ![]() |
Ovary | 13.15 | ![]() |
Pancreas | 4.8 | ![]() |
PancreaticIslet | 31 | ![]() |
ParietalLobe | 6.6 | ![]() |
Pituitary | 6.8 | ![]() |
Placenta | 6.3 | ![]() |
Pons | 5.75 | ![]() |
PrefrontalCortex | 7.6 | ![]() |
Prostate | 6.7 | ![]() |
Salivarygland | 4.75 | ![]() |
SkeletalMuscle | 7.5 | ![]() |
Skin | 4.8 | ![]() |
SmoothMuscle | 13.4 | ![]() |
Spinalcord | 7.15 | ![]() |
SubthalamicNucleus | 5.4 | ![]() |
SuperiorCervicalGanglion | 8.05 | ![]() |
TemporalLobe | 5.45 | ![]() |
Testis | 4.9 | ![]() |
TestisGermCell | 5.6 | ![]() |
TestisIntersitial | 5.05 | ![]() |
TestisLeydigCell | 5.9 | ![]() |
TestisSeminiferousTubule | 5.15 | ![]() |
Thalamus | 6.05 | ![]() |
Thymus | 4.3 | ![]() |
Thyroid | 13.75 | ![]() |
Tongue | 6.65 | ![]() |
Tonsil | 5.9 | ![]() |
Trachea | 4.85 | ![]() |
TrigeminalGanglion | 6.9 | ![]() |
Uterus | 13.15 | ![]() |
UterusCorpus | 5.75 | ![]() |
WholeBlood | 6.15 | ![]() |
Wholebrain | 5.2 | ![]() |
colon | 5.7 | ![]() |
pineal_day | 6.76 | ![]() |
pineal_night | 6.76 | ![]() |
retina | 13.375 | ![]() |
small_intestine | 5.4 | ![]() |
- Probe name: CUST_670_PI416408490
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 4.4 ± 0.7 | ![]() ![]() ![]() |
Basal Forebrain | 4.45 ± 0.47 | ![]() ![]() ![]() |
Basal Part of Pons | 4.62 ± 0.69 | ![]() ![]() ![]() |
Cerebellar Cortex | 4.76 ± 0.51 | ![]() ![]() ![]() |
Cerebellar Nuclei | 4.79 ± 0.53 | ![]() ![]() ![]() |
Claustrum | 4.33 ± 0.62 | ![]() ![]() ![]() |
Epithalamus | 4.06 ± 0.88 | ![]() ![]() ![]() |
Frontal Lobe | 4.58 ± 0.54 | ![]() ![]() ![]() |
Globus Pallidus | 4.37 ± 0.69 | ![]() ![]() ![]() |
Hypothalamus | 4.33 ± 0.63 | ![]() ![]() ![]() |
Insula | 4.67 ± 0.43 | ![]() ![]() ![]() |
Limbic Lobe | 4.43 ± 0.6 | ![]() ![]() ![]() |
Mesencephalon | 4.53 ± 0.6 | ![]() ![]() ![]() |
Myelencephalon | 4.5 ± 0.6 | ![]() ![]() ![]() |
Occipital Lobe | 4.02 ± 0.64 | ![]() ![]() ![]() |
Parietal Lobe | 4.3 ± 0.59 | ![]() ![]() ![]() |
Pontine Tegmentum | 4.47 ± 0.64 | ![]() ![]() ![]() |
Striatum | 4.97 ± 0.55 | ![]() ![]() ![]() |
Subthalamus | 4.74 ± 0.39 | ![]() ![]() ![]() |
Temporal Lobe | 4.48 ± 0.58 | ![]() ![]() ![]() |
Thalamus | 4.41 ± 0.6 | ![]() ![]() ![]() |
White Matter | 6.46 ± 0.43 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Vldlr | CB | Cerebellum | 0 | ![]() |
0 | ![]() | |||
Vldlr | CTX | Cerebral cortex | 0 | ![]() |
0 | ![]() | |||
Vldlr | HIP | Hippocampal region | 0 | ![]() |
0 | ![]() | |||
Vldlr | HPF | Hippocampal formation | 0 | ![]() |
0 | ![]() | |||
Vldlr | HY | Hypothalamus | 0 | ![]() |
0 | ![]() | |||
Vldlr | LSX | Lateral septal complex | 0 | ![]() |
0 | ![]() | |||
Vldlr | MB | Midbrain | 0 | ![]() |
0 | ![]() | |||
Vldlr | MY | Medulla | 0 | ![]() |
0 | ![]() | |||
Vldlr | OLF | Olfactory bulb | 0 | ![]() |
0 | ![]() | |||
Vldlr | P | Pons | 0 | ![]() |
0 | ![]() | |||
Vldlr | PAL | Pallidum | 0 | ![]() |
0 | ![]() | |||
Vldlr | RHP | Retrohippocampal region | 0 | ![]() |
0 | ![]() | |||
Vldlr | sAMY | Striatum-like amygdalar nuclei | 0 | ![]() |
0 | ![]() | |||
Vldlr | STR | Striatum | 0 | ![]() |
0 | ![]() | |||
Vldlr | STRd | Striatum dorsal region | 0 | ![]() |
0 | ![]() | |||
Vldlr | STRv | Striatum ventral region | 0 | ![]() |
0 | ![]() | |||
Vldlr | TH | Thalamus | 0 | ![]() |
0 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00040330 | 31 | 673 | 703 | FTGSELATLVNNLNDAQDIIVYHELVQPSGK | Peptide Atlas |
VLDLR_HUMAN_450 | 9 | 450 | 458 | DIRKIGLER | PRIDE |