Annotation Detail for CAD


Gene Symbol: | CAD ( - ) |
---|---|
Gene Full Name: | carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase |
Band: | 2p23.3 |
Quick Links | Entrez ID:790; OMIM: 114010; Uniprot ID:PYR1_HUMAN; ENSEMBL ID: ENSG00000084774; HGNC ID: 1424 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.377010
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 9 / 70761 | 127 | ![]() |
blastocyst | 14 / 62319 | 224 | ![]() |
fetus | 14 / 564012 | 24 | ![]() |
neonate | 4 / 31097 | 128 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 1 / 55556 | 17 | ![]() |
adult | 82 / 1939121 | 42 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 2 / 12794 | 156 | ![]() |
bladder carcinoma | 1 / 17475 | 57 | ![]() |
breast (mammary gland) tumor | 11 / 94178 | 116 | ![]() |
cervical tumor | 3 / 34366 | 87 | ![]() |
chondrosarcoma | 5 / 82823 | 60 | ![]() |
colorectal tumor | 12 / 114246 | 105 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 7 / 119369 | 58 | ![]() |
germ cell tumor | 19 / 263845 | 72 | ![]() |
glioma | 8 / 106883 | 74 | ![]() |
head and neck tumor | 12 / 136302 | 88 | ![]() |
kidney tumor | 2 / 68959 | 29 | ![]() |
leukemia | 20 / 95842 | 208 | ![]() |
liver tumor | 4 / 96359 | 41 | ![]() |
lung tumor | 9 / 103127 | 87 | ![]() |
lymphoma | 26 / 71755 | 362 | ![]() |
non-neoplasia | 1 / 97250 | 10 | ![]() |
normal | 112 / 3360307 | 33 | ![]() |
ovarian tumor | 3 / 76682 | 39 | ![]() |
pancreatic tumor | 8 / 104616 | 76 | ![]() |
primitive neuroectodermal tumor of the CNS | 15 / 125680 | 119 | ![]() |
prostate cancer | 9 / 102680 | 87 | ![]() |
retinoblastoma | 25 / 46356 | 539 | ![]() |
skin tumor | 12 / 124949 | 96 | ![]() |
soft tissue/muscle tissue tumor | 10 / 125191 | 79 | ![]() |
uterine tumor | 6 / 90257 | 66 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 2 / 33197 | 60 | ![]() |
ascites | 2 / 40015 | 49 | ![]() |
bladder | 0 / 29757 | 0 | |
blood | 6 / 123478 | 48 | ![]() |
bone | 9 / 71655 | 125 | ![]() |
bone marrow | 17 / 48801 | 348 | ![]() |
brain | 23 / 1100989 | 20 | ![]() |
cervix | 3 / 48171 | 62 | ![]() |
connective tissue | 4 / 149255 | 26 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 27 / 215722 | 125 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 35 / 211054 | 165 | ![]() |
heart | 4 / 89626 | 44 | ![]() |
intestine | 17 / 234472 | 72 | ![]() |
kidney | 4 / 211777 | 18 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 6 / 207743 | 28 | ![]() |
lung | 18 / 336974 | 53 | ![]() |
lymph | 26 / 44270 | 587 | ![]() |
lymph node | 31 / 91610 | 338 | ![]() |
mammary gland | 12 / 153271 | 78 | ![]() |
mouth | 8 / 67052 | 119 | ![]() |
muscle | 3 / 107715 | 27 | ![]() |
nerve | 1 / 15768 | 63 | ![]() |
ovary | 7 / 102051 | 68 | ![]() |
pancreas | 13 / 214812 | 60 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 1 / 41328 | 24 | ![]() |
pituitary gland | 0 / 16585 | 0 | |
placenta | 1 / 280825 | 3 | ![]() |
prostate | 9 / 189345 | 47 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 14 / 210574 | 66 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 2 / 96619 | 20 | ![]() |
testis | 6 / 330442 | 18 | ![]() |
thymus | 1 / 81131 | 12 | ![]() |
thyroid | 4 / 47473 | 84 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 4 / 13680 | 292 | ![]() |
uterus | 18 / 232878 | 77 | ![]() |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202715_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 149.75 | ![]() |
Adipocyte | 8.45 | ![]() |
AdrenalCortex | 4.1 | ![]() |
Adrenalgland | 3.6 | ![]() |
Amygdala | 4.5 | ![]() |
Appendix | 4.3 | ![]() |
AtrioventricularNode | 3 | ![]() |
BDCA4+_DentriticCells | 6.9 | ![]() |
Bonemarrow | 4.4 | ![]() |
BronchialEpithelialCells | 4.3 | ![]() |
CD105+_Endothelial | 24.55 | ![]() |
CD14+_Monocytes | 3.85 | ![]() |
CD19+_BCells(neg._sel.) | 8.8 | ![]() |
CD33+_Myeloid | 5.7 | ![]() |
CD34+ | 96.45 | ![]() |
CD4+_Tcells | 23.25 | ![]() |
CD56+_NKCells | 7.8 | ![]() |
CD71+_EarlyErythroid | 4 | ![]() |
CD8+_Tcells | 12.65 | ![]() |
CardiacMyocytes | 6.35 | ![]() |
Caudatenucleus | 3.85 | ![]() |
Cerebellum | 3.45 | ![]() |
CerebellumPeduncles | 4.9 | ![]() |
CiliaryGanglion | 2.95 | ![]() |
CingulateCortex | 4.4 | ![]() |
Colorectaladenocarcinoma | 66.45 | ![]() |
DorsalRootGanglion | 3.2 | ![]() |
FetalThyroid | 4.9 | ![]() |
Fetalbrain | 4.5 | ![]() |
Fetalliver | 3.75 | ![]() |
Fetallung | 3.6 | ![]() |
GlobusPallidus | 3.15 | ![]() |
Heart | 5.35 | ![]() |
Hypothalamus | 4.4 | ![]() |
Kidney | 3.5 | ![]() |
Leukemia_chronicMyelogenousK-562 | 33.05 | ![]() |
Leukemia_promyelocytic-HL-60 | 26.1 | ![]() |
Leukemialymphoblastic(MOLT-4) | 24.05 | ![]() |
Liver | 5.65 | ![]() |
Lung | 4.95 | ![]() |
Lymphnode | 4 | ![]() |
Lymphoma_burkitts(Daudi) | 20.95 | ![]() |
Lymphoma_burkitts(Raji) | 10.45 | ![]() |
MedullaOblongata | 3.95 | ![]() |
OccipitalLobe | 3.9 | ![]() |
OlfactoryBulb | 3.4 | ![]() |
Ovary | 2.9 | ![]() |
Pancreas | 4.3 | ![]() |
PancreaticIslet | 5 | ![]() |
ParietalLobe | 4.5 | ![]() |
Pituitary | 5 | ![]() |
Placenta | 4.5 | ![]() |
Pons | 4.1 | ![]() |
PrefrontalCortex | 4.9 | ![]() |
Prostate | 5.15 | ![]() |
Salivarygland | 3.4 | ![]() |
SkeletalMuscle | 4.9 | ![]() |
Skin | 3.3 | ![]() |
SmoothMuscle | 4.95 | ![]() |
Spinalcord | 4.65 | ![]() |
SubthalamicNucleus | 3.9 | ![]() |
SuperiorCervicalGanglion | 4.8 | ![]() |
TemporalLobe | 3.95 | ![]() |
Testis | 4.05 | ![]() |
TestisGermCell | 3.75 | ![]() |
TestisIntersitial | 3.65 | ![]() |
TestisLeydigCell | 4.25 | ![]() |
TestisSeminiferousTubule | 3.7 | ![]() |
Thalamus | 4.05 | ![]() |
Thymus | 8.7 | ![]() |
Thyroid | 5.5 | ![]() |
Tongue | 3.9 | ![]() |
Tonsil | 4.25 | ![]() |
Trachea | 3.35 | ![]() |
TrigeminalGanglion | 4.25 | ![]() |
Uterus | 3.8 | ![]() |
UterusCorpus | 3.8 | ![]() |
WholeBlood | 4.7 | ![]() |
Wholebrain | 3.6 | ![]() |
colon | 3.75 | ![]() |
pineal_day | 5.58 | ![]() |
pineal_night | 5.72 | ![]() |
retina | 5.2 | ![]() |
small_intestine | 3.9 | ![]() |
- Probe name: CUST_9008_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.76 ± 0.56 | ![]() ![]() ![]() |
Basal Forebrain | 3.82 ± 0.46 | ![]() ![]() ![]() |
Basal Part of Pons | 4.03 ± 0.52 | ![]() ![]() ![]() |
Cerebellar Cortex | 4.35 ± 0.51 | ![]() ![]() ![]() |
Cerebellar Nuclei | 3.68 ± 0.49 | ![]() ![]() ![]() |
Claustrum | 3.49 ± 0.94 | ![]() ![]() ![]() |
Epithalamus | 4.24 ± 0.83 | ![]() ![]() ![]() |
Frontal Lobe | 3.96 ± 0.64 | ![]() ![]() ![]() |
Globus Pallidus | 3.88 ± 0.32 | ![]() ![]() ![]() |
Hypothalamus | 3.49 ± 0.77 | ![]() ![]() ![]() |
Insula | 3.94 ± 0.48 | ![]() ![]() ![]() |
Limbic Lobe | 3.69 ± 0.64 | ![]() ![]() ![]() |
Mesencephalon | 3.9 ± 0.57 | ![]() ![]() ![]() |
Myelencephalon | 3.94 ± 0.58 | ![]() ![]() ![]() |
Occipital Lobe | 3.56 ± 0.66 | ![]() ![]() ![]() |
Parietal Lobe | 3.85 ± 0.55 | ![]() ![]() ![]() |
Pontine Tegmentum | 3.71 ± 0.74 | ![]() ![]() ![]() |
Striatum | 3.63 ± 0.57 | ![]() ![]() ![]() |
Subthalamus | 3.49 ± 0.31 | ![]() ![]() ![]() |
Temporal Lobe | 4 ± 0.53 | ![]() ![]() ![]() |
Thalamus | 4.05 ± 0.52 | ![]() ![]() ![]() |
White Matter | 3.96 ± 0.6 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Cad | CB | Cerebellum | 2.47 | ![]() |
3.32 | ![]() | |||
Cad | CTX | Cerebral cortex | 1.35 | ![]() |
1.75 | ![]() | |||
Cad | HIP | Hippocampal region | 1.16 | ![]() |
1.5 | ![]() | |||
Cad | HPF | Hippocampal formation | 1.37 | ![]() |
1.62 | ![]() | |||
Cad | HY | Hypothalamus | 2.62 | ![]() |
3.46 | ![]() | |||
Cad | LSX | Lateral septal complex | 0.11 | ![]() |
0.07 | ![]() | |||
Cad | MB | Midbrain | 0.65 | ![]() |
0.81 | ![]() | |||
Cad | MY | Medulla | 1.66 | ![]() |
2.03 | ![]() | |||
Cad | OLF | Olfactory bulb | 1.34 | ![]() |
1.11 | ![]() | |||
Cad | P | Pons | 3.8 | ![]() |
5.29 | ![]() | |||
Cad | PAL | Pallidum | 0.14 | ![]() |
0.15 | ![]() | |||
Cad | RHP | Retrohippocampal region | 1.7 | ![]() |
1.77 | ![]() | |||
Cad | sAMY | Striatum-like amygdalar nuclei | 0.06 | ![]() |
0.06 | ![]() | |||
Cad | STR | Striatum | 0.35 | ![]() |
0.44 | ![]() | |||
Cad | STRd | Striatum dorsal region | 0.42 | ![]() |
0.54 | ![]() | |||
Cad | STRv | Striatum ventral region | 0.35 | ![]() |
0.41 | ![]() | |||
Cad | TH | Thalamus | 1.63 | ![]() |
2.15 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00000148 | 37 | 556 | 592 | AAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDK | Peptide Atlas |
PYR1_HUMAN_1053 | 13 | 1053 | 1065 | LLDTIGISQPQWR | PRIDE |
PYR1_HUMAN_1417 | 14 | 1417 | 1430 | LAADFSVPLIIDIK | PRIDE |
PYR1_HUMAN_157 | 12 | 157 | 168 | PLVPEVSIKTPR | PRIDE |
PYR1_HUMAN_1609 | 9 | 1609 | 1617 | SVHICHVAR | PRIDE |
PYR1_HUMAN_1935 | 14 | 1935 | 1948 | DQMSHLFNVAHTLR | PRIDE |
PYR1_HUMAN_2 | 12 | 2 | 13 | AALVLEDGSVLR | PRIDE |
PYR1_HUMAN_2151 | 23 | 2151 | 2173 | FGSTQEYEACFGQFILTPHIMTR | PRIDE |
PYR1_HUMAN_3 | 11 | 3 | 13 | ALVLEDGSVLR | PRIDE |
PYR1_HUMAN_555 | 37 | 555 | 591 | AAFALGGLGSGFASNREELSALVAPAFAHTSQVLVDK | PRIDE |
PYR1_HUMAN_761 | 10 | 761 | 770 | SVGEVMGIGR | PRIDE |
PYR1_HUMAN_771 | 11 | 771 | 781 | SFEEAFQKALR | PRIDE |
PYR1_HUMAN_875 | 14 | 875 | 888 | QIALAVLSTELAVR | PRIDE |