Annotation Detail for DCTPP1
Basic Information Top
Gene Symbol: | DCTPP1 ( MGC5627,RS21C6,XTP3TPA ) |
---|---|
Gene Full Name: | dCTP pyrophosphatase 1 |
Band: | 16p11.2 |
Quick Links | Entrez ID:79077; OMIM: NA; Uniprot ID:DCTP1_HUMAN; ENSEMBL ID: ENSG00000179958; HGNC ID: 28777 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.632191
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 9 / 70761 | 127 | |
blastocyst | 4 / 62319 | 64 | |
fetus | 18 / 564012 | 31 | |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 1 / 55556 | 17 | |
adult | 100 / 1939121 | 51 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 1 / 17475 | 57 | |
breast (mammary gland) tumor | 7 / 94178 | 74 | |
cervical tumor | 3 / 34366 | 87 | |
chondrosarcoma | 3 / 82823 | 36 | |
colorectal tumor | 7 / 114246 | 61 | |
esophageal tumor | 1 / 17290 | 57 | |
gastrointestinal tumor | 11 / 119369 | 92 | |
germ cell tumor | 12 / 263845 | 45 | |
glioma | 14 / 106883 | 130 | |
head and neck tumor | 4 / 136302 | 29 | |
kidney tumor | 2 / 68959 | 29 | |
leukemia | 8 / 95842 | 83 | |
liver tumor | 5 / 96359 | 51 | |
lung tumor | 10 / 103127 | 96 | |
lymphoma | 3 / 71755 | 41 | |
non-neoplasia | 2 / 97250 | 20 | |
normal | 102 / 3360307 | 30 | |
ovarian tumor | 6 / 76682 | 78 | |
pancreatic tumor | 14 / 104616 | 133 | |
primitive neuroectodermal tumor of the CNS | 10 / 125680 | 79 | |
prostate cancer | 27 / 102680 | 262 | |
retinoblastoma | 13 / 46356 | 280 | |
skin tumor | 4 / 124949 | 32 | |
soft tissue/muscle tissue tumor | 12 / 125191 | 95 | |
uterine tumor | 3 / 90257 | 33 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 3 / 13106 | 228 | |
adrenal gland | 1 / 33197 | 30 | |
ascites | 9 / 40015 | 224 | |
bladder | 1 / 29757 | 33 | |
blood | 9 / 123478 | 72 | |
bone | 3 / 71655 | 41 | |
bone marrow | 1 / 48801 | 20 | |
brain | 33 / 1100989 | 29 | |
cervix | 9 / 48171 | 186 | |
connective tissue | 8 / 149255 | 53 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 18 / 215722 | 83 | |
esophagus | 1 / 20209 | 49 | |
eye | 20 / 211054 | 94 | |
heart | 2 / 89626 | 22 | |
intestine | 13 / 234472 | 55 | |
kidney | 6 / 211777 | 28 | |
larynx | 0 / 24145 | 0 | |
liver | 7 / 207743 | 33 | |
lung | 25 / 336974 | 74 | |
lymph | 1 / 44270 | 22 | |
lymph node | 7 / 91610 | 76 | |
mammary gland | 9 / 153271 | 58 | |
mouth | 2 / 67052 | 29 | |
muscle | 5 / 107715 | 46 | |
nerve | 1 / 15768 | 63 | |
ovary | 5 / 102051 | 48 | |
pancreas | 15 / 214812 | 69 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 1 / 41328 | 24 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 11 / 280825 | 39 | |
prostate | 29 / 189345 | 153 | |
salivary gland | 1 / 20155 | 49 | |
skin | 5 / 210574 | 23 | |
spleen | 1 / 53952 | 18 | |
stomach | 2 / 96619 | 20 | |
testis | 5 / 330442 | 15 | |
thymus | 0 / 81131 | 0 | |
thyroid | 1 / 47473 | 21 | |
tonsil | 3 / 16999 | 176 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 9 / 232878 | 38 | |
vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 218069_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 267.25 | |
Adipocyte | 17.7 | |
AdrenalCortex | 21.2 | |
Adrenalgland | 19.25 | |
Amygdala | 17.55 | |
Appendix | 14.85 | |
AtrioventricularNode | 15.55 | |
BDCA4+_DentriticCells | 53.55 | |
Bonemarrow | 28.4 | |
BronchialEpithelialCells | 86.4 | |
CD105+_Endothelial | 91.75 | |
CD14+_Monocytes | 13.95 | |
CD19+_BCells(neg._sel.) | 61.2 | |
CD33+_Myeloid | 32.25 | |
CD34+ | 205.1 | |
CD4+_Tcells | 20.55 | |
CD56+_NKCells | 40 | |
CD71+_EarlyErythroid | 18.75 | |
CD8+_Tcells | 18.85 | |
CardiacMyocytes | 13.7 | |
Caudatenucleus | 18.25 | |
Cerebellum | 31.1 | |
CerebellumPeduncles | 27.95 | |
CiliaryGanglion | 15.25 | |
CingulateCortex | 20.95 | |
Colorectaladenocarcinoma | 20.5 | |
DorsalRootGanglion | 14.9 | |
FetalThyroid | 19.2 | |
Fetalbrain | 22.9 | |
Fetalliver | 17.9 | |
Fetallung | 15.45 | |
GlobusPallidus | 14.4 | |
Heart | 67.5 | |
Hypothalamus | 23.2 | |
Kidney | 30.45 | |
Leukemia_chronicMyelogenousK-562 | 57.2 | |
Leukemia_promyelocytic-HL-60 | 58.45 | |
Leukemialymphoblastic(MOLT-4) | 70.45 | |
Liver | 29.1 | |
Lung | 27.55 | |
Lymphnode | 16.45 | |
Lymphoma_burkitts(Daudi) | 111.5 | |
Lymphoma_burkitts(Raji) | 15.45 | |
MedullaOblongata | 18.1 | |
OccipitalLobe | 20.25 | |
OlfactoryBulb | 15.7 | |
Ovary | 7.5 | |
Pancreas | 15.75 | |
PancreaticIslet | 16.1 | |
ParietalLobe | 21.05 | |
Pituitary | 23.3 | |
Placenta | 19.75 | |
Pons | 17.15 | |
PrefrontalCortex | 25.75 | |
Prostate | 23.75 | |
Salivarygland | 16.7 | |
SkeletalMuscle | 24.05 | |
Skin | 14.9 | |
SmoothMuscle | 15.5 | |
Spinalcord | 21.8 | |
SubthalamicNucleus | 17.75 | |
SuperiorCervicalGanglion | 21.85 | |
TemporalLobe | 18.45 | |
Testis | 20.9 | |
TestisGermCell | 14.5 | |
TestisIntersitial | 14.6 | |
TestisLeydigCell | 14.85 | |
TestisSeminiferousTubule | 16.6 | |
Thalamus | 22.6 | |
Thymus | 18.35 | |
Thyroid | 25.3 | |
Tongue | 14.1 | |
Tonsil | 22.6 | |
Trachea | 20.95 | |
TrigeminalGanglion | 12.75 | |
Uterus | 16.15 | |
UterusCorpus | 7.5 | |
WholeBlood | 12.1 | |
Wholebrain | 28.45 | |
colon | 168.15 | |
pineal_day | 36.54 | |
pineal_night | 22.76 | |
retina | 28.175 | |
small_intestine | 51.75 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_23_P33613
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 7.33 ± 0.53 | |
Basal Forebrain | 7.7 ± 0.33 | |
Basal Part of Pons | 8.38 ± 0.55 | |
Cerebellar Cortex | 8.28 ± 0.34 | |
Cerebellar Nuclei | 8.2 ± 0.48 | |
Claustrum | 7.63 ± 0.93 | |
Epithalamus | 8.02 ± 0.49 | |
Frontal Lobe | 8.14 ± 0.48 | |
Globus Pallidus | 7.06 ± 0.32 | |
Hypothalamus | 8.55 ± 0.31 | |
Insula | 8.24 ± 0.36 | |
Limbic Lobe | 7.48 ± 0.79 | |
Mesencephalon | 7.73 ± 0.6 | |
Myelencephalon | 7.78 ± 0.74 | |
Occipital Lobe | 6.89 ± 0.75 | |
Parietal Lobe | 7.76 ± 0.58 | |
Pontine Tegmentum | 7.75 ± 0.55 | |
Striatum | 6.84 ± 0.51 | |
Subthalamus | 8.58 ± 0.18 | |
Temporal Lobe | 8.18 ± 0.54 | |
Thalamus | 7.72 ± 0.55 | |
White Matter | 7.29 ± 0.32 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
2410015N17Rik | CB | Cerebellum | 1.16 | |
2.07 | ||||
2410015N17Rik | CTX | Cerebral cortex | 9.91 | |
7.77 | ||||
2410015N17Rik | HIP | Hippocampal region | 5.44 | |
5.4 | ||||
2410015N17Rik | HPF | Hippocampal formation | 5.63 | |
5.04 | ||||
2410015N17Rik | HY | Hypothalamus | 0.18 | |
0.41 | ||||
2410015N17Rik | LSX | Lateral septal complex | 0.08 | |
0.07 | ||||
2410015N17Rik | MB | Midbrain | 1.06 | |
2.32 | ||||
2410015N17Rik | MY | Medulla | 1.01 | |
2.99 | ||||
2410015N17Rik | OLF | Olfactory bulb | 6.66 | |
6.07 | ||||
2410015N17Rik | P | Pons | 1.21 | |
3.05 | ||||
2410015N17Rik | PAL | Pallidum | 0.65 | |
0.67 | ||||
2410015N17Rik | RHP | Retrohippocampal region | 5.97 | |
4.54 | ||||
2410015N17Rik | sAMY | Striatum-like amygdalar nuclei | 3.61 | |
2.65 | ||||
2410015N17Rik | STR | Striatum | 1.74 | |
1.33 | ||||
2410015N17Rik | STRd | Striatum dorsal region | 1.72 | |
1.32 | ||||
2410015N17Rik | STRv | Striatum ventral region | 1.09 | |
0.83 | ||||
2410015N17Rik | TH | Thalamus | 0.93 | |
1.22 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
DCTP1_HUMAN_74 | 13 | 74 | 86 | TDGEPGPQGWSPR | PRIDE |
DCTP1_HUMAN_87 | 24 | 87 | 110 | ERAALQEELSDVLIYLVALAARCR | PRIDE |
PAp00004661 | 31 | 140 | 170 | KYTELPHGAISEDQAVGPADIPCDSTGQTST | Peptide Atlas |