Annotation Detail for DOCK8
Basic Information Top
Gene Symbol: | DOCK8 ( FLJ00026,FLJ00152,FLJ00346,MRD2,ZIR8 ) |
---|---|
Gene Full Name: | dedicator of cytokinesis 8 |
Band: | 9p24.3 |
Quick Links | Entrez ID:81704; OMIM: 611432; Uniprot ID:DOCK8_HUMAN; ENSEMBL ID: ENSG00000107099; HGNC ID: 19191 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.132599
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 11 / 564012 | 19 | |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 3 / 55556 | 53 | |
adult | 55 / 1939121 | 28 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 1 / 12794 | 78 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 1 / 82823 | 12 | |
colorectal tumor | 5 / 114246 | 43 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 15 / 263845 | 56 | |
glioma | 2 / 106883 | 18 | |
head and neck tumor | 3 / 136302 | 22 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 10 / 95842 | 104 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 1 / 103127 | 9 | |
lymphoma | 3 / 71755 | 41 | |
non-neoplasia | 1 / 97250 | 10 | |
normal | 142 / 3360307 | 42 | |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 1 / 104616 | 9 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 3 / 46356 | 64 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 1 / 125191 | 7 | |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 1 / 13106 | 76 | |
adrenal gland | 3 / 33197 | 90 | |
ascites | 0 / 40015 | 0 | |
bladder | 1 / 29757 | 33 | |
blood | 12 / 123478 | 97 | |
bone | 0 / 71655 | 0 | |
bone marrow | 3 / 48801 | 61 | |
brain | 8 / 1100989 | 7 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 1 / 149255 | 6 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 0 / 20209 | 0 | |
eye | 7 / 211054 | 33 | |
heart | 0 / 89626 | 0 | |
intestine | 5 / 234472 | 21 | |
kidney | 9 / 211777 | 42 | |
larynx | 1 / 24145 | 41 | |
liver | 0 / 207743 | 0 | |
lung | 6 / 336974 | 17 | |
lymph | 1 / 44270 | 22 | |
lymph node | 34 / 91610 | 371 | |
mammary gland | 1 / 153271 | 6 | |
mouth | 2 / 67052 | 29 | |
muscle | 1 / 107715 | 9 | |
nerve | 2 / 15768 | 126 | |
ovary | 0 / 102051 | 0 | |
pancreas | 2 / 214812 | 9 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 4 / 41328 | 96 | |
pituitary gland | 1 / 16585 | 60 | |
placenta | 11 / 280825 | 39 | |
prostate | 6 / 189345 | 31 | |
salivary gland | 0 / 20155 | 0 | |
skin | 13 / 210574 | 61 | |
spleen | 5 / 53952 | 92 | |
stomach | 0 / 96619 | 0 | |
testis | 17 / 330442 | 51 | |
thymus | 9 / 81131 | 110 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 0 / 232878 | 0 | |
vascular | 1 / 51780 | 19 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_23_P353888
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 2.85 ± 0.97 | |
Basal Forebrain | 2.57 ± 0.57 | |
Basal Part of Pons | 2.8 ± 0.71 | |
Cerebellar Cortex | 2.21 ± 0.46 | |
Cerebellar Nuclei | 3.85 ± 0.56 | |
Claustrum | 3.11 ± 0.63 | |
Epithalamus | 3.26 ± 0.53 | |
Frontal Lobe | 2.52 ± 0.9 | |
Globus Pallidus | 4.56 ± 0.48 | |
Hypothalamus | 2.53 ± 0.85 | |
Insula | 2.48 ± 0.71 | |
Limbic Lobe | 2.59 ± 0.85 | |
Mesencephalon | 2.79 ± 0.79 | |
Myelencephalon | 2.7 ± 0.8 | |
Occipital Lobe | 2.41 ± 0.61 | |
Parietal Lobe | 2.69 ± 0.78 | |
Pontine Tegmentum | 2.71 ± 0.88 | |
Striatum | 2.96 ± 0.82 | |
Subthalamus | 3.15 ± 0.27 | |
Temporal Lobe | 2.73 ± 0.79 | |
Thalamus | 2.69 ± 0.71 | |
White Matter | 4.53 ± 0.33 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
DOCK8_HUMAN_1490 | 7 | 1490 | 1496 | MFGTYFR | PRIDE |
DOCK8_HUMAN_330 | 39 | 330 | 368 | SAVFSVTYPSSDIYLVVKIEKVLQQGEIGDCAEPYTVIK | PRIDE |
PAp00003430 | 11 | 113 | 123 | HLNVLCDVSGK | Peptide Atlas |