Annotation Detail for SMC1A


Gene Symbol: | SMC1A ( CDLS2,DKFZp686L19178,DXS423E,KIAA0178,MGC138332,SB1.8,SMC1,SMC1L1,SMC1alpha,SMCB ) |
---|---|
Gene Full Name: | structural maintenance of chromosomes 1A |
Band: | Xp11.22 |
Quick Links | Entrez ID:8243; OMIM: 300040; Uniprot ID:SMC1A_HUMAN; ENSEMBL ID: ENSG00000072501; HGNC ID: 11111 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.211602
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 6 / 70761 | 84 | ![]() |
blastocyst | 12 / 62319 | 192 | ![]() |
fetus | 43 / 564012 | 76 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 1 / 23620 | 42 | ![]() |
juvenile | 4 / 55556 | 71 | ![]() |
adult | 138 / 1939121 | 71 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 2 / 17475 | 114 | ![]() |
breast (mammary gland) tumor | 26 / 94178 | 276 | ![]() |
cervical tumor | 9 / 34366 | 261 | ![]() |
chondrosarcoma | 4 / 82823 | 48 | ![]() |
colorectal tumor | 12 / 114246 | 105 | ![]() |
esophageal tumor | 3 / 17290 | 173 | ![]() |
gastrointestinal tumor | 13 / 119369 | 108 | ![]() |
germ cell tumor | 43 / 263845 | 162 | ![]() |
glioma | 4 / 106883 | 37 | ![]() |
head and neck tumor | 16 / 136302 | 117 | ![]() |
kidney tumor | 12 / 68959 | 174 | ![]() |
leukemia | 9 / 95842 | 93 | ![]() |
liver tumor | 8 / 96359 | 83 | ![]() |
lung tumor | 10 / 103127 | 96 | ![]() |
lymphoma | 7 / 71755 | 97 | ![]() |
non-neoplasia | 4 / 97250 | 41 | ![]() |
normal | 231 / 3360307 | 68 | ![]() |
ovarian tumor | 5 / 76682 | 65 | ![]() |
pancreatic tumor | 5 / 104616 | 47 | ![]() |
primitive neuroectodermal tumor of the CNS | 6 / 125680 | 47 | ![]() |
prostate cancer | 6 / 102680 | 58 | ![]() |
retinoblastoma | 6 / 46356 | 129 | ![]() |
skin tumor | 13 / 124949 | 104 | ![]() |
soft tissue/muscle tissue tumor | 14 / 125191 | 111 | ![]() |
uterine tumor | 11 / 90257 | 121 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 1 / 33197 | 30 | ![]() |
ascites | 3 / 40015 | 74 | ![]() |
bladder | 6 / 29757 | 201 | ![]() |
blood | 4 / 123478 | 32 | ![]() |
bone | 3 / 71655 | 41 | ![]() |
bone marrow | 5 / 48801 | 102 | ![]() |
brain | 49 / 1100989 | 44 | ![]() |
cervix | 9 / 48171 | 186 | ![]() |
connective tissue | 5 / 149255 | 33 | ![]() |
ear | 1 / 16212 | 61 | ![]() |
embryonic tissue | 23 / 215722 | 106 | ![]() |
esophagus | 3 / 20209 | 148 | ![]() |
eye | 22 / 211054 | 104 | ![]() |
heart | 4 / 89626 | 44 | ![]() |
intestine | 21 / 234472 | 89 | ![]() |
kidney | 20 / 211777 | 94 | ![]() |
larynx | 4 / 24145 | 165 | ![]() |
liver | 41 / 207743 | 197 | ![]() |
lung | 21 / 336974 | 62 | ![]() |
lymph | 2 / 44270 | 45 | ![]() |
lymph node | 19 / 91610 | 207 | ![]() |
mammary gland | 29 / 153271 | 189 | ![]() |
mouth | 12 / 67052 | 178 | ![]() |
muscle | 8 / 107715 | 74 | ![]() |
nerve | 1 / 15768 | 63 | ![]() |
ovary | 7 / 102051 | 68 | ![]() |
pancreas | 8 / 214812 | 37 | ![]() |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 2 / 16585 | 120 | ![]() |
placenta | 9 / 280825 | 32 | ![]() |
prostate | 11 / 189345 | 58 | ![]() |
salivary gland | 2 / 20155 | 99 | ![]() |
skin | 16 / 210574 | 75 | ![]() |
spleen | 5 / 53952 | 92 | ![]() |
stomach | 3 / 96619 | 31 | ![]() |
testis | 17 / 330442 | 51 | ![]() |
thymus | 3 / 81131 | 36 | ![]() |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 26 / 232878 | 111 | ![]() |
vascular | 5 / 51780 | 96 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201589_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 1363.15 | ![]() |
Adipocyte | 13.85 | ![]() |
AdrenalCortex | 16.2 | ![]() |
Adrenalgland | 13.15 | ![]() |
Amygdala | 19.3 | ![]() |
Appendix | 15.2 | ![]() |
AtrioventricularNode | 12.1 | ![]() |
BDCA4+_DentriticCells | 310.5 | ![]() |
Bonemarrow | 54.05 | ![]() |
BronchialEpithelialCells | 56.75 | ![]() |
CD105+_Endothelial | 596.85 | ![]() |
CD14+_Monocytes | 196.8 | ![]() |
CD19+_BCells(neg._sel.) | 104.9 | ![]() |
CD33+_Myeloid | 519.1 | ![]() |
CD34+ | 596.05 | ![]() |
CD4+_Tcells | 214.8 | ![]() |
CD56+_NKCells | 234.8 | ![]() |
CD71+_EarlyErythroid | 339.25 | ![]() |
CD8+_Tcells | 225.45 | ![]() |
CardiacMyocytes | 26.65 | ![]() |
Caudatenucleus | 14.05 | ![]() |
Cerebellum | 10.25 | ![]() |
CerebellumPeduncles | 15 | ![]() |
CiliaryGanglion | 11 | ![]() |
CingulateCortex | 12.65 | ![]() |
Colorectaladenocarcinoma | 197.1 | ![]() |
DorsalRootGanglion | 11.75 | ![]() |
FetalThyroid | 14.35 | ![]() |
Fetalbrain | 12.7 | ![]() |
Fetalliver | 207.95 | ![]() |
Fetallung | 44.2 | ![]() |
GlobusPallidus | 9.55 | ![]() |
Heart | 20.6 | ![]() |
Hypothalamus | 16.25 | ![]() |
Kidney | 14.4 | ![]() |
Leukemia_chronicMyelogenousK-562 | 161.85 | ![]() |
Leukemia_promyelocytic-HL-60 | 159.85 | ![]() |
Leukemialymphoblastic(MOLT-4) | 329.85 | ![]() |
Liver | 20.2 | ![]() |
Lung | 36.8 | ![]() |
Lymphnode | 74.15 | ![]() |
Lymphoma_burkitts(Daudi) | 188.75 | ![]() |
Lymphoma_burkitts(Raji) | 35 | ![]() |
MedullaOblongata | 12.15 | ![]() |
OccipitalLobe | 11.1 | ![]() |
OlfactoryBulb | 12.9 | ![]() |
Ovary | 9.9 | ![]() |
Pancreas | 16.7 | ![]() |
PancreaticIslet | 15.2 | ![]() |
ParietalLobe | 13.05 | ![]() |
Pituitary | 20.85 | ![]() |
Placenta | 112.65 | ![]() |
Pons | 11.3 | ![]() |
PrefrontalCortex | 19.1 | ![]() |
Prostate | 46.6 | ![]() |
Salivarygland | 13.6 | ![]() |
SkeletalMuscle | 18.55 | ![]() |
Skin | 11.8 | ![]() |
SmoothMuscle | 23.05 | ![]() |
Spinalcord | 20.55 | ![]() |
SubthalamicNucleus | 10.8 | ![]() |
SuperiorCervicalGanglion | 18.95 | ![]() |
TemporalLobe | 12 | ![]() |
Testis | 12.8 | ![]() |
TestisGermCell | 10.7 | ![]() |
TestisIntersitial | 11.45 | ![]() |
TestisLeydigCell | 11.3 | ![]() |
TestisSeminiferousTubule | 10.9 | ![]() |
Thalamus | 14.5 | ![]() |
Thymus | 257.3 | ![]() |
Thyroid | 83.65 | ![]() |
Tongue | 15.7 | ![]() |
Tonsil | 29.7 | ![]() |
Trachea | 30.75 | ![]() |
TrigeminalGanglion | 15.45 | ![]() |
Uterus | 80.25 | ![]() |
UterusCorpus | 14.65 | ![]() |
WholeBlood | 169.25 | ![]() |
Wholebrain | 11.45 | ![]() |
colon | 441.45 | ![]() |
pineal_day | 76.04 | ![]() |
pineal_night | 80.34 | ![]() |
retina | 84.825 | ![]() |
small_intestine | 398.9 | ![]() |
- Probe name: A_23_P217411
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 8.02 ± 0.25 | ![]() ![]() ![]() |
Basal Forebrain | 8.38 ± 0.2 | ![]() ![]() ![]() |
Basal Part of Pons | 7.62 ± 0.24 | ![]() ![]() ![]() |
Cerebellar Cortex | 8.4 ± 0.19 | ![]() ![]() ![]() |
Cerebellar Nuclei | 8.21 ± 0.38 | ![]() ![]() ![]() |
Claustrum | 8.22 ± 0.41 | ![]() ![]() ![]() |
Epithalamus | 8.56 ± 0.18 | ![]() ![]() ![]() |
Frontal Lobe | 7.87 ± 0.34 | ![]() ![]() ![]() |
Globus Pallidus | 8.44 ± 0.49 | ![]() ![]() ![]() |
Hypothalamus | 7.79 ± 0.24 | ![]() ![]() ![]() |
Insula | 7.76 ± 0.37 | ![]() ![]() ![]() |
Limbic Lobe | 7.95 ± 0.43 | ![]() ![]() ![]() |
Mesencephalon | 8.22 ± 0.34 | ![]() ![]() ![]() |
Myelencephalon | 8.1 ± 0.41 | ![]() ![]() ![]() |
Occipital Lobe | 8.48 ± 0.42 | ![]() ![]() ![]() |
Parietal Lobe | 8.04 ± 0.31 | ![]() ![]() ![]() |
Pontine Tegmentum | 8.11 ± 0.35 | ![]() ![]() ![]() |
Striatum | 8.18 ± 0.51 | ![]() ![]() ![]() |
Subthalamus | 7.8 ± 0.25 | ![]() ![]() ![]() |
Temporal Lobe | 7.92 ± 0.29 | ![]() ![]() ![]() |
Thalamus | 8.26 ± 0.22 | ![]() ![]() ![]() |
White Matter | 9.21 ± 0.35 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Smc1a | CB | Cerebellum | 10.57 | ![]() |
11.31 | ![]() | |||
Smc1a | CTX | Cerebral cortex | 5.49 | ![]() |
4.35 | ![]() | |||
Smc1a | HIP | Hippocampal region | 11.09 | ![]() |
11.38 | ![]() | |||
Smc1a | HPF | Hippocampal formation | 8.82 | ![]() |
8.69 | ![]() | |||
Smc1a | HY | Hypothalamus | 1.33 | ![]() |
1.19 | ![]() | |||
Smc1a | LSX | Lateral septal complex | 1.07 | ![]() |
1.25 | ![]() | |||
Smc1a | MB | Midbrain | 3.74 | ![]() |
3.76 | ![]() | |||
Smc1a | MY | Medulla | 6.32 | ![]() |
7.11 | ![]() | |||
Smc1a | OLF | Olfactory bulb | 8 | ![]() |
6.79 | ![]() | |||
Smc1a | P | Pons | 5.53 | ![]() |
6.23 | ![]() | |||
Smc1a | PAL | Pallidum | 1.83 | ![]() |
1.83 | ![]() | |||
Smc1a | RHP | Retrohippocampal region | 4.37 | ![]() |
4.69 | ![]() | |||
Smc1a | sAMY | Striatum-like amygdalar nuclei | 0.61 | ![]() |
0.46 | ![]() | |||
Smc1a | STR | Striatum | 1.19 | ![]() |
1.12 | ![]() | |||
Smc1a | STRd | Striatum dorsal region | 0.8 | ![]() |
0.87 | ![]() | |||
Smc1a | STRv | Striatum ventral region | 2.79 | ![]() |
2.14 | ![]() | |||
Smc1a | TH | Thalamus | 2.11 | ![]() |
1.95 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00005979 | 31 | 1091 | 1121 | NSSAQAFLGPENPEEPYLDGINYNCVAPGKR | Peptide Atlas |
SMC1A_HUMAN_2 | 17 | 2 | 18 | GFLKLIEIENFKSYKGR | PRIDE |
SMC1A_HUMAN_39 | 14 | 39 | 52 | SNLMDAISFVLGEK | PRIDE |
SMC1A_HUMAN_700 | 12 | 700 | 711 | QVQSQAHGLQMR | PRIDE |