Annotation Detail for SMC1A
Basic Information Top
| Gene Symbol: | SMC1A ( CDLS2,DKFZp686L19178,DXS423E,KIAA0178,MGC138332,SB1.8,SMC1,SMC1L1,SMC1alpha,SMCB ) |
|---|---|
| Gene Full Name: | structural maintenance of chromosomes 1A |
| Band: | Xp11.22 |
| Quick Links | Entrez ID:8243; OMIM: 300040; Uniprot ID:SMC1A_HUMAN; ENSEMBL ID: ENSG00000072501; HGNC ID: 11111 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.211602
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 6 / 70761 | 84 | |
| blastocyst | 12 / 62319 | 192 | |
| fetus | 43 / 564012 | 76 | |
| neonate | 0 / 31097 | 0 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 4 / 55556 | 71 | |
| adult | 138 / 1939121 | 71 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 2 / 17475 | 114 | |
| breast (mammary gland) tumor | 26 / 94178 | 276 | |
| cervical tumor | 9 / 34366 | 261 | |
| chondrosarcoma | 4 / 82823 | 48 | |
| colorectal tumor | 12 / 114246 | 105 | |
| esophageal tumor | 3 / 17290 | 173 | |
| gastrointestinal tumor | 13 / 119369 | 108 | |
| germ cell tumor | 43 / 263845 | 162 | |
| glioma | 4 / 106883 | 37 | |
| head and neck tumor | 16 / 136302 | 117 | |
| kidney tumor | 12 / 68959 | 174 | |
| leukemia | 9 / 95842 | 93 | |
| liver tumor | 8 / 96359 | 83 | |
| lung tumor | 10 / 103127 | 96 | |
| lymphoma | 7 / 71755 | 97 | |
| non-neoplasia | 4 / 97250 | 41 | |
| normal | 231 / 3360307 | 68 | |
| ovarian tumor | 5 / 76682 | 65 | |
| pancreatic tumor | 5 / 104616 | 47 | |
| primitive neuroectodermal tumor of the CNS | 6 / 125680 | 47 | |
| prostate cancer | 6 / 102680 | 58 | |
| retinoblastoma | 6 / 46356 | 129 | |
| skin tumor | 13 / 124949 | 104 | |
| soft tissue/muscle tissue tumor | 14 / 125191 | 111 | |
| uterine tumor | 11 / 90257 | 121 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 1 / 33197 | 30 | |
| ascites | 3 / 40015 | 74 | |
| bladder | 6 / 29757 | 201 | |
| blood | 4 / 123478 | 32 | |
| bone | 3 / 71655 | 41 | |
| bone marrow | 5 / 48801 | 102 | |
| brain | 49 / 1100989 | 44 | |
| cervix | 9 / 48171 | 186 | |
| connective tissue | 5 / 149255 | 33 | |
| ear | 1 / 16212 | 61 | |
| embryonic tissue | 23 / 215722 | 106 | |
| esophagus | 3 / 20209 | 148 | |
| eye | 22 / 211054 | 104 | |
| heart | 4 / 89626 | 44 | |
| intestine | 21 / 234472 | 89 | |
| kidney | 20 / 211777 | 94 | |
| larynx | 4 / 24145 | 165 | |
| liver | 41 / 207743 | 197 | |
| lung | 21 / 336974 | 62 | |
| lymph | 2 / 44270 | 45 | |
| lymph node | 19 / 91610 | 207 | |
| mammary gland | 29 / 153271 | 189 | |
| mouth | 12 / 67052 | 178 | |
| muscle | 8 / 107715 | 74 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 7 / 102051 | 68 | |
| pancreas | 8 / 214812 | 37 | |
| parathyroid | 1 / 20539 | 48 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 2 / 16585 | 120 | |
| placenta | 9 / 280825 | 32 | |
| prostate | 11 / 189345 | 58 | |
| salivary gland | 2 / 20155 | 99 | |
| skin | 16 / 210574 | 75 | |
| spleen | 5 / 53952 | 92 | |
| stomach | 3 / 96619 | 31 | |
| testis | 17 / 330442 | 51 | |
| thymus | 3 / 81131 | 36 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 0 / 52413 | 0 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 26 / 232878 | 111 | |
| vascular | 5 / 51780 | 96 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201589_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 1363.15 | |
| Adipocyte | 13.85 | |
| AdrenalCortex | 16.2 | |
| Adrenalgland | 13.15 | |
| Amygdala | 19.3 | |
| Appendix | 15.2 | |
| AtrioventricularNode | 12.1 | |
| BDCA4+_DentriticCells | 310.5 | |
| Bonemarrow | 54.05 | |
| BronchialEpithelialCells | 56.75 | |
| CD105+_Endothelial | 596.85 | |
| CD14+_Monocytes | 196.8 | |
| CD19+_BCells(neg._sel.) | 104.9 | |
| CD33+_Myeloid | 519.1 | |
| CD34+ | 596.05 | |
| CD4+_Tcells | 214.8 | |
| CD56+_NKCells | 234.8 | |
| CD71+_EarlyErythroid | 339.25 | |
| CD8+_Tcells | 225.45 | |
| CardiacMyocytes | 26.65 | |
| Caudatenucleus | 14.05 | |
| Cerebellum | 10.25 | |
| CerebellumPeduncles | 15 | |
| CiliaryGanglion | 11 | |
| CingulateCortex | 12.65 | |
| Colorectaladenocarcinoma | 197.1 | |
| DorsalRootGanglion | 11.75 | |
| FetalThyroid | 14.35 | |
| Fetalbrain | 12.7 | |
| Fetalliver | 207.95 | |
| Fetallung | 44.2 | |
| GlobusPallidus | 9.55 | |
| Heart | 20.6 | |
| Hypothalamus | 16.25 | |
| Kidney | 14.4 | |
| Leukemia_chronicMyelogenousK-562 | 161.85 | |
| Leukemia_promyelocytic-HL-60 | 159.85 | |
| Leukemialymphoblastic(MOLT-4) | 329.85 | |
| Liver | 20.2 | |
| Lung | 36.8 | |
| Lymphnode | 74.15 | |
| Lymphoma_burkitts(Daudi) | 188.75 | |
| Lymphoma_burkitts(Raji) | 35 | |
| MedullaOblongata | 12.15 | |
| OccipitalLobe | 11.1 | |
| OlfactoryBulb | 12.9 | |
| Ovary | 9.9 | |
| Pancreas | 16.7 | |
| PancreaticIslet | 15.2 | |
| ParietalLobe | 13.05 | |
| Pituitary | 20.85 | |
| Placenta | 112.65 | |
| Pons | 11.3 | |
| PrefrontalCortex | 19.1 | |
| Prostate | 46.6 | |
| Salivarygland | 13.6 | |
| SkeletalMuscle | 18.55 | |
| Skin | 11.8 | |
| SmoothMuscle | 23.05 | |
| Spinalcord | 20.55 | |
| SubthalamicNucleus | 10.8 | |
| SuperiorCervicalGanglion | 18.95 | |
| TemporalLobe | 12 | |
| Testis | 12.8 | |
| TestisGermCell | 10.7 | |
| TestisIntersitial | 11.45 | |
| TestisLeydigCell | 11.3 | |
| TestisSeminiferousTubule | 10.9 | |
| Thalamus | 14.5 | |
| Thymus | 257.3 | |
| Thyroid | 83.65 | |
| Tongue | 15.7 | |
| Tonsil | 29.7 | |
| Trachea | 30.75 | |
| TrigeminalGanglion | 15.45 | |
| Uterus | 80.25 | |
| UterusCorpus | 14.65 | |
| WholeBlood | 169.25 | |
| Wholebrain | 11.45 | |
| colon | 441.45 | |
| pineal_day | 76.04 | |
| pineal_night | 80.34 | |
| retina | 84.825 | |
| small_intestine | 398.9 |
- Probe name: A_23_P217411
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 8.02 ± 0.25 | |
| Basal Forebrain | 8.38 ± 0.2 | |
| Basal Part of Pons | 7.62 ± 0.24 | |
| Cerebellar Cortex | 8.4 ± 0.19 | |
| Cerebellar Nuclei | 8.21 ± 0.38 | |
| Claustrum | 8.22 ± 0.41 | |
| Epithalamus | 8.56 ± 0.18 | |
| Frontal Lobe | 7.87 ± 0.34 | |
| Globus Pallidus | 8.44 ± 0.49 | |
| Hypothalamus | 7.79 ± 0.24 | |
| Insula | 7.76 ± 0.37 | |
| Limbic Lobe | 7.95 ± 0.43 | |
| Mesencephalon | 8.22 ± 0.34 | |
| Myelencephalon | 8.1 ± 0.41 | |
| Occipital Lobe | 8.48 ± 0.42 | |
| Parietal Lobe | 8.04 ± 0.31 | |
| Pontine Tegmentum | 8.11 ± 0.35 | |
| Striatum | 8.18 ± 0.51 | |
| Subthalamus | 7.8 ± 0.25 | |
| Temporal Lobe | 7.92 ± 0.29 | |
| Thalamus | 8.26 ± 0.22 | |
| White Matter | 9.21 ± 0.35 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Smc1a | CB | Cerebellum | 10.57 | |
| 11.31 | ||||
| Smc1a | CTX | Cerebral cortex | 5.49 | |
| 4.35 | ||||
| Smc1a | HIP | Hippocampal region | 11.09 | |
| 11.38 | ||||
| Smc1a | HPF | Hippocampal formation | 8.82 | |
| 8.69 | ||||
| Smc1a | HY | Hypothalamus | 1.33 | |
| 1.19 | ||||
| Smc1a | LSX | Lateral septal complex | 1.07 | |
| 1.25 | ||||
| Smc1a | MB | Midbrain | 3.74 | |
| 3.76 | ||||
| Smc1a | MY | Medulla | 6.32 | |
| 7.11 | ||||
| Smc1a | OLF | Olfactory bulb | 8 | |
| 6.79 | ||||
| Smc1a | P | Pons | 5.53 | |
| 6.23 | ||||
| Smc1a | PAL | Pallidum | 1.83 | |
| 1.83 | ||||
| Smc1a | RHP | Retrohippocampal region | 4.37 | |
| 4.69 | ||||
| Smc1a | sAMY | Striatum-like amygdalar nuclei | 0.61 | |
| 0.46 | ||||
| Smc1a | STR | Striatum | 1.19 | |
| 1.12 | ||||
| Smc1a | STRd | Striatum dorsal region | 0.8 | |
| 0.87 | ||||
| Smc1a | STRv | Striatum ventral region | 2.79 | |
| 2.14 | ||||
| Smc1a | TH | Thalamus | 2.11 | |
| 1.95 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00005979 | 31 | 1091 | 1121 | NSSAQAFLGPENPEEPYLDGINYNCVAPGKR | Peptide Atlas |
| SMC1A_HUMAN_2 | 17 | 2 | 18 | GFLKLIEIENFKSYKGR | PRIDE |
| SMC1A_HUMAN_39 | 14 | 39 | 52 | SNLMDAISFVLGEK | PRIDE |
| SMC1A_HUMAN_700 | 12 | 700 | 711 | QVQSQAHGLQMR | PRIDE |



