Annotation Detail for SMARCA5
Basic Information Top
| Gene Symbol: | SMARCA5 ( ISWI,SNF2H,WCRF135,hISWI,hSNF2H ) |
|---|---|
| Gene Full Name: | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 |
| Band: | 4q31.21 |
| Quick Links | Entrez ID:8467; OMIM: 603375; Uniprot ID:SMCA5_HUMAN; ENSEMBL ID: ENSG00000153147; HGNC ID: 11101 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.558422
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 15 / 70761 | 211 | |
| blastocyst | 24 / 62319 | 385 | |
| fetus | 57 / 564012 | 101 | |
| neonate | 2 / 31097 | 64 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 7 / 55556 | 125 | |
| adult | 173 / 1939121 | 89 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 3 / 12794 | 234 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 6 / 94178 | 63 | |
| cervical tumor | 1 / 34366 | 29 | |
| chondrosarcoma | 8 / 82823 | 96 | |
| colorectal tumor | 9 / 114246 | 78 | |
| esophageal tumor | 3 / 17290 | 173 | |
| gastrointestinal tumor | 7 / 119369 | 58 | |
| germ cell tumor | 55 / 263845 | 208 | |
| glioma | 3 / 106883 | 28 | |
| head and neck tumor | 14 / 136302 | 102 | |
| kidney tumor | 4 / 68959 | 58 | |
| leukemia | 4 / 95842 | 41 | |
| liver tumor | 8 / 96359 | 83 | |
| lung tumor | 1 / 103127 | 9 | |
| lymphoma | 4 / 71755 | 55 | |
| non-neoplasia | 5 / 97250 | 51 | |
| normal | 358 / 3360307 | 106 | |
| ovarian tumor | 1 / 76682 | 13 | |
| pancreatic tumor | 5 / 104616 | 47 | |
| primitive neuroectodermal tumor of the CNS | 3 / 125680 | 23 | |
| prostate cancer | 5 / 102680 | 48 | |
| retinoblastoma | 4 / 46356 | 86 | |
| skin tumor | 12 / 124949 | 96 | |
| soft tissue/muscle tissue tumor | 11 / 125191 | 87 | |
| uterine tumor | 6 / 90257 | 66 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 4 / 13106 | 305 | |
| adrenal gland | 4 / 33197 | 120 | |
| ascites | 2 / 40015 | 49 | |
| bladder | 4 / 29757 | 134 | |
| blood | 5 / 123478 | 40 | |
| bone | 6 / 71655 | 83 | |
| bone marrow | 6 / 48801 | 122 | |
| brain | 117 / 1100989 | 106 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 10 / 149255 | 66 | |
| ear | 5 / 16212 | 308 | |
| embryonic tissue | 51 / 215722 | 236 | |
| esophagus | 3 / 20209 | 148 | |
| eye | 15 / 211054 | 71 | |
| heart | 8 / 89626 | 89 | |
| intestine | 15 / 234472 | 63 | |
| kidney | 20 / 211777 | 94 | |
| larynx | 1 / 24145 | 41 | |
| liver | 10 / 207743 | 48 | |
| lung | 23 / 336974 | 68 | |
| lymph | 1 / 44270 | 22 | |
| lymph node | 22 / 91610 | 240 | |
| mammary gland | 12 / 153271 | 78 | |
| mouth | 14 / 67052 | 208 | |
| muscle | 2 / 107715 | 18 | |
| nerve | 3 / 15768 | 190 | |
| ovary | 1 / 102051 | 9 | |
| pancreas | 15 / 214812 | 69 | |
| parathyroid | 2 / 20539 | 97 | |
| pharynx | 1 / 41328 | 24 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 22 / 280825 | 78 | |
| prostate | 11 / 189345 | 58 | |
| salivary gland | 2 / 20155 | 99 | |
| skin | 17 / 210574 | 80 | |
| spleen | 2 / 53952 | 37 | |
| stomach | 1 / 96619 | 10 | |
| testis | 92 / 330442 | 278 | |
| thymus | 10 / 81131 | 123 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 15 / 52413 | 286 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 25 / 232878 | 107 | |
| vascular | 7 / 51780 | 135 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202303_x_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 143.5 | |
| Adipocyte | 8.35 | |
| AdrenalCortex | 8.9 | |
| Adrenalgland | 6.5 | |
| Amygdala | 7.85 | |
| Appendix | 8.4 | |
| AtrioventricularNode | 6.85 | |
| BDCA4+_DentriticCells | 74.45 | |
| Bonemarrow | 7.5 | |
| BronchialEpithelialCells | 20.95 | |
| CD105+_Endothelial | 100.55 | |
| CD14+_Monocytes | 16.7 | |
| CD19+_BCells(neg._sel.) | 42.35 | |
| CD33+_Myeloid | 27.95 | |
| CD34+ | 95.6 | |
| CD4+_Tcells | 58.65 | |
| CD56+_NKCells | 55.5 | |
| CD71+_EarlyErythroid | 37.7 | |
| CD8+_Tcells | 48.05 | |
| CardiacMyocytes | 13.25 | |
| Caudatenucleus | 7 | |
| Cerebellum | 5.35 | |
| CerebellumPeduncles | 8.75 | |
| CiliaryGanglion | 6.2 | |
| CingulateCortex | 7.6 | |
| Colorectaladenocarcinoma | 7.95 | |
| DorsalRootGanglion | 6.45 | |
| FetalThyroid | 8.15 | |
| Fetalbrain | 9.35 | |
| Fetalliver | 10.2 | |
| Fetallung | 38.35 | |
| GlobusPallidus | 5.8 | |
| Heart | 10.1 | |
| Hypothalamus | 8.5 | |
| Kidney | 5.9 | |
| Leukemia_chronicMyelogenousK-562 | 9.55 | |
| Leukemia_promyelocytic-HL-60 | 29.3 | |
| Leukemialymphoblastic(MOLT-4) | 56.55 | |
| Liver | 10.15 | |
| Lung | 8.35 | |
| Lymphnode | 6.95 | |
| Lymphoma_burkitts(Daudi) | 36.6 | |
| Lymphoma_burkitts(Raji) | 12.8 | |
| MedullaOblongata | 7 | |
| OccipitalLobe | 7.1 | |
| OlfactoryBulb | 6.15 | |
| Ovary | 5.8 | |
| Pancreas | 8.15 | |
| PancreaticIslet | 20.9 | |
| ParietalLobe | 9.35 | |
| Pituitary | 15.8 | |
| Placenta | 7 | |
| Pons | 7.15 | |
| PrefrontalCortex | 10.65 | |
| Prostate | 8 | |
| Salivarygland | 6.75 | |
| SkeletalMuscle | 9.45 | |
| Skin | 6.6 | |
| SmoothMuscle | 13.65 | |
| Spinalcord | 8.35 | |
| SubthalamicNucleus | 8.05 | |
| SuperiorCervicalGanglion | 9.65 | |
| TemporalLobe | 6.75 | |
| Testis | 6.3 | |
| TestisGermCell | 65.8 | |
| TestisIntersitial | 12.2 | |
| TestisLeydigCell | 15.15 | |
| TestisSeminiferousTubule | 25.9 | |
| Thalamus | 8 | |
| Thymus | 5.3 | |
| Thyroid | 9.6 | |
| Tongue | 7.45 | |
| Tonsil | 8.25 | |
| Trachea | 6.55 | |
| TrigeminalGanglion | 9.3 | |
| Uterus | 6.25 | |
| UterusCorpus | 7.15 | |
| WholeBlood | 12.4 | |
| Wholebrain | 5.6 | |
| colon | 7.85 | |
| pineal_day | 54.9 | |
| pineal_night | 36.72 | |
| retina | 9.575 | |
| small_intestine | 7.3 |
- Probe name: CUST_6479_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 9.22 ± 0.21 | |
| Basal Forebrain | 9.19 ± 0.24 | |
| Basal Part of Pons | 8.93 ± 0.21 | |
| Cerebellar Cortex | 8.91 ± 0.15 | |
| Cerebellar Nuclei | 9.3 ± 0.28 | |
| Claustrum | 9.4 ± 0.3 | |
| Epithalamus | 9.3 ± 0.36 | |
| Frontal Lobe | 9.01 ± 0.3 | |
| Globus Pallidus | 9.83 ± 0.14 | |
| Hypothalamus | 9.19 ± 0.2 | |
| Insula | 9.04 ± 0.24 | |
| Limbic Lobe | 9.1 ± 0.27 | |
| Mesencephalon | 9.33 ± 0.2 | |
| Myelencephalon | 9.15 ± 0.29 | |
| Occipital Lobe | 9.34 ± 0.27 | |
| Parietal Lobe | 9.14 ± 0.25 | |
| Pontine Tegmentum | 9.15 ± 0.25 | |
| Striatum | 9.33 ± 0.26 | |
| Subthalamus | 9.42 ± 0.23 | |
| Temporal Lobe | 9.03 ± 0.27 | |
| Thalamus | 9.1 ± 0.24 | |
| White Matter | 10.19 ± 0.25 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Smarca5 | CB | Cerebellum | 25.49 | |
| 28.5 | ||||
| Smarca5 | CTX | Cerebral cortex | 55.12 | |
| 40.71 | ||||
| Smarca5 | HIP | Hippocampal region | 45.57 | |
| 78.63 | ||||
| Smarca5 | HPF | Hippocampal formation | 45.46 | |
| 59.37 | ||||
| Smarca5 | HY | Hypothalamus | 47.45 | |
| 39.06 | ||||
| Smarca5 | LSX | Lateral septal complex | 37.31 | |
| 27.65 | ||||
| Smarca5 | MB | Midbrain | 40.38 | |
| 35.48 | ||||
| Smarca5 | MY | Medulla | 48.1 | |
| 49.57 | ||||
| Smarca5 | OLF | Olfactory bulb | 49.99 | |
| 41.36 | ||||
| Smarca5 | P | Pons | 38.43 | |
| 39.98 | ||||
| Smarca5 | PAL | Pallidum | 32.17 | |
| 27.97 | ||||
| Smarca5 | RHP | Retrohippocampal region | 46.29 | |
| 37.92 | ||||
| Smarca5 | sAMY | Striatum-like amygdalar nuclei | 32.78 | |
| 23.89 | ||||
| Smarca5 | STR | Striatum | 32.05 | |
| 22.99 | ||||
| Smarca5 | STRd | Striatum dorsal region | 29.96 | |
| 21.64 | ||||
| Smarca5 | STRv | Striatum ventral region | 37.34 | |
| 25.44 | ||||
| Smarca5 | TH | Thalamus | 32.48 | |
| 29.8 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00001221 | 9 | 891 | 899 | CNELQDIEK | Peptide Atlas |
| SMCA5_HUMAN_227 | 12 | 227 | 238 | NIPGPHMVLVPK | PRIDE |
| SMCA5_HUMAN_35 | 35 | 35 | 69 | GGPEGVAAQAVASAASAGPADAEMEEIFDDASPGK | PRIDE |
| SMCA5_HUMAN_750 | 9 | 750 | 758 | EALRVSEPK | PRIDE |
| SMCA5_HUMAN_98 | 22 | 98 | 119 | QTELFAHFIQPAAQKTPTSPLK | PRIDE |



