Annotation Detail for SMARCA5


Gene Symbol: | SMARCA5 ( ISWI,SNF2H,WCRF135,hISWI,hSNF2H ) |
---|---|
Gene Full Name: | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 |
Band: | 4q31.21 |
Quick Links | Entrez ID:8467; OMIM: 603375; Uniprot ID:SMCA5_HUMAN; ENSEMBL ID: ENSG00000153147; HGNC ID: 11101 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.558422
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 15 / 70761 | 211 | ![]() |
blastocyst | 24 / 62319 | 385 | ![]() |
fetus | 57 / 564012 | 101 | ![]() |
neonate | 2 / 31097 | 64 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 7 / 55556 | 125 | ![]() |
adult | 173 / 1939121 | 89 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 3 / 12794 | 234 | ![]() |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 6 / 94178 | 63 | ![]() |
cervical tumor | 1 / 34366 | 29 | ![]() |
chondrosarcoma | 8 / 82823 | 96 | ![]() |
colorectal tumor | 9 / 114246 | 78 | ![]() |
esophageal tumor | 3 / 17290 | 173 | ![]() |
gastrointestinal tumor | 7 / 119369 | 58 | ![]() |
germ cell tumor | 55 / 263845 | 208 | ![]() |
glioma | 3 / 106883 | 28 | ![]() |
head and neck tumor | 14 / 136302 | 102 | ![]() |
kidney tumor | 4 / 68959 | 58 | ![]() |
leukemia | 4 / 95842 | 41 | ![]() |
liver tumor | 8 / 96359 | 83 | ![]() |
lung tumor | 1 / 103127 | 9 | ![]() |
lymphoma | 4 / 71755 | 55 | ![]() |
non-neoplasia | 5 / 97250 | 51 | ![]() |
normal | 358 / 3360307 | 106 | ![]() |
ovarian tumor | 1 / 76682 | 13 | ![]() |
pancreatic tumor | 5 / 104616 | 47 | ![]() |
primitive neuroectodermal tumor of the CNS | 3 / 125680 | 23 | ![]() |
prostate cancer | 5 / 102680 | 48 | ![]() |
retinoblastoma | 4 / 46356 | 86 | ![]() |
skin tumor | 12 / 124949 | 96 | ![]() |
soft tissue/muscle tissue tumor | 11 / 125191 | 87 | ![]() |
uterine tumor | 6 / 90257 | 66 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 4 / 13106 | 305 | ![]() |
adrenal gland | 4 / 33197 | 120 | ![]() |
ascites | 2 / 40015 | 49 | ![]() |
bladder | 4 / 29757 | 134 | ![]() |
blood | 5 / 123478 | 40 | ![]() |
bone | 6 / 71655 | 83 | ![]() |
bone marrow | 6 / 48801 | 122 | ![]() |
brain | 117 / 1100989 | 106 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 10 / 149255 | 66 | ![]() |
ear | 5 / 16212 | 308 | ![]() |
embryonic tissue | 51 / 215722 | 236 | ![]() |
esophagus | 3 / 20209 | 148 | ![]() |
eye | 15 / 211054 | 71 | ![]() |
heart | 8 / 89626 | 89 | ![]() |
intestine | 15 / 234472 | 63 | ![]() |
kidney | 20 / 211777 | 94 | ![]() |
larynx | 1 / 24145 | 41 | ![]() |
liver | 10 / 207743 | 48 | ![]() |
lung | 23 / 336974 | 68 | ![]() |
lymph | 1 / 44270 | 22 | ![]() |
lymph node | 22 / 91610 | 240 | ![]() |
mammary gland | 12 / 153271 | 78 | ![]() |
mouth | 14 / 67052 | 208 | ![]() |
muscle | 2 / 107715 | 18 | ![]() |
nerve | 3 / 15768 | 190 | ![]() |
ovary | 1 / 102051 | 9 | ![]() |
pancreas | 15 / 214812 | 69 | ![]() |
parathyroid | 2 / 20539 | 97 | ![]() |
pharynx | 1 / 41328 | 24 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 22 / 280825 | 78 | ![]() |
prostate | 11 / 189345 | 58 | ![]() |
salivary gland | 2 / 20155 | 99 | ![]() |
skin | 17 / 210574 | 80 | ![]() |
spleen | 2 / 53952 | 37 | ![]() |
stomach | 1 / 96619 | 10 | ![]() |
testis | 92 / 330442 | 278 | ![]() |
thymus | 10 / 81131 | 123 | ![]() |
thyroid | 2 / 47473 | 42 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 15 / 52413 | 286 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 25 / 232878 | 107 | ![]() |
vascular | 7 / 51780 | 135 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 202303_x_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 143.5 | ![]() |
Adipocyte | 8.35 | ![]() |
AdrenalCortex | 8.9 | ![]() |
Adrenalgland | 6.5 | ![]() |
Amygdala | 7.85 | ![]() |
Appendix | 8.4 | ![]() |
AtrioventricularNode | 6.85 | ![]() |
BDCA4+_DentriticCells | 74.45 | ![]() |
Bonemarrow | 7.5 | ![]() |
BronchialEpithelialCells | 20.95 | ![]() |
CD105+_Endothelial | 100.55 | ![]() |
CD14+_Monocytes | 16.7 | ![]() |
CD19+_BCells(neg._sel.) | 42.35 | ![]() |
CD33+_Myeloid | 27.95 | ![]() |
CD34+ | 95.6 | ![]() |
CD4+_Tcells | 58.65 | ![]() |
CD56+_NKCells | 55.5 | ![]() |
CD71+_EarlyErythroid | 37.7 | ![]() |
CD8+_Tcells | 48.05 | ![]() |
CardiacMyocytes | 13.25 | ![]() |
Caudatenucleus | 7 | ![]() |
Cerebellum | 5.35 | ![]() |
CerebellumPeduncles | 8.75 | ![]() |
CiliaryGanglion | 6.2 | ![]() |
CingulateCortex | 7.6 | ![]() |
Colorectaladenocarcinoma | 7.95 | ![]() |
DorsalRootGanglion | 6.45 | ![]() |
FetalThyroid | 8.15 | ![]() |
Fetalbrain | 9.35 | ![]() |
Fetalliver | 10.2 | ![]() |
Fetallung | 38.35 | ![]() |
GlobusPallidus | 5.8 | ![]() |
Heart | 10.1 | ![]() |
Hypothalamus | 8.5 | ![]() |
Kidney | 5.9 | ![]() |
Leukemia_chronicMyelogenousK-562 | 9.55 | ![]() |
Leukemia_promyelocytic-HL-60 | 29.3 | ![]() |
Leukemialymphoblastic(MOLT-4) | 56.55 | ![]() |
Liver | 10.15 | ![]() |
Lung | 8.35 | ![]() |
Lymphnode | 6.95 | ![]() |
Lymphoma_burkitts(Daudi) | 36.6 | ![]() |
Lymphoma_burkitts(Raji) | 12.8 | ![]() |
MedullaOblongata | 7 | ![]() |
OccipitalLobe | 7.1 | ![]() |
OlfactoryBulb | 6.15 | ![]() |
Ovary | 5.8 | ![]() |
Pancreas | 8.15 | ![]() |
PancreaticIslet | 20.9 | ![]() |
ParietalLobe | 9.35 | ![]() |
Pituitary | 15.8 | ![]() |
Placenta | 7 | ![]() |
Pons | 7.15 | ![]() |
PrefrontalCortex | 10.65 | ![]() |
Prostate | 8 | ![]() |
Salivarygland | 6.75 | ![]() |
SkeletalMuscle | 9.45 | ![]() |
Skin | 6.6 | ![]() |
SmoothMuscle | 13.65 | ![]() |
Spinalcord | 8.35 | ![]() |
SubthalamicNucleus | 8.05 | ![]() |
SuperiorCervicalGanglion | 9.65 | ![]() |
TemporalLobe | 6.75 | ![]() |
Testis | 6.3 | ![]() |
TestisGermCell | 65.8 | ![]() |
TestisIntersitial | 12.2 | ![]() |
TestisLeydigCell | 15.15 | ![]() |
TestisSeminiferousTubule | 25.9 | ![]() |
Thalamus | 8 | ![]() |
Thymus | 5.3 | ![]() |
Thyroid | 9.6 | ![]() |
Tongue | 7.45 | ![]() |
Tonsil | 8.25 | ![]() |
Trachea | 6.55 | ![]() |
TrigeminalGanglion | 9.3 | ![]() |
Uterus | 6.25 | ![]() |
UterusCorpus | 7.15 | ![]() |
WholeBlood | 12.4 | ![]() |
Wholebrain | 5.6 | ![]() |
colon | 7.85 | ![]() |
pineal_day | 54.9 | ![]() |
pineal_night | 36.72 | ![]() |
retina | 9.575 | ![]() |
small_intestine | 7.3 | ![]() |
- Probe name: CUST_6479_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 9.22 ± 0.21 | ![]() ![]() ![]() |
Basal Forebrain | 9.19 ± 0.24 | ![]() ![]() ![]() |
Basal Part of Pons | 8.93 ± 0.21 | ![]() ![]() ![]() |
Cerebellar Cortex | 8.91 ± 0.15 | ![]() ![]() ![]() |
Cerebellar Nuclei | 9.3 ± 0.28 | ![]() ![]() ![]() |
Claustrum | 9.4 ± 0.3 | ![]() ![]() ![]() |
Epithalamus | 9.3 ± 0.36 | ![]() ![]() ![]() |
Frontal Lobe | 9.01 ± 0.3 | ![]() ![]() ![]() |
Globus Pallidus | 9.83 ± 0.14 | ![]() ![]() ![]() |
Hypothalamus | 9.19 ± 0.2 | ![]() ![]() ![]() |
Insula | 9.04 ± 0.24 | ![]() ![]() ![]() |
Limbic Lobe | 9.1 ± 0.27 | ![]() ![]() ![]() |
Mesencephalon | 9.33 ± 0.2 | ![]() ![]() ![]() |
Myelencephalon | 9.15 ± 0.29 | ![]() ![]() ![]() |
Occipital Lobe | 9.34 ± 0.27 | ![]() ![]() ![]() |
Parietal Lobe | 9.14 ± 0.25 | ![]() ![]() ![]() |
Pontine Tegmentum | 9.15 ± 0.25 | ![]() ![]() ![]() |
Striatum | 9.33 ± 0.26 | ![]() ![]() ![]() |
Subthalamus | 9.42 ± 0.23 | ![]() ![]() ![]() |
Temporal Lobe | 9.03 ± 0.27 | ![]() ![]() ![]() |
Thalamus | 9.1 ± 0.24 | ![]() ![]() ![]() |
White Matter | 10.19 ± 0.25 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Smarca5 | CB | Cerebellum | 25.49 | ![]() |
28.5 | ![]() | |||
Smarca5 | CTX | Cerebral cortex | 55.12 | ![]() |
40.71 | ![]() | |||
Smarca5 | HIP | Hippocampal region | 45.57 | ![]() |
78.63 | ![]() | |||
Smarca5 | HPF | Hippocampal formation | 45.46 | ![]() |
59.37 | ![]() | |||
Smarca5 | HY | Hypothalamus | 47.45 | ![]() |
39.06 | ![]() | |||
Smarca5 | LSX | Lateral septal complex | 37.31 | ![]() |
27.65 | ![]() | |||
Smarca5 | MB | Midbrain | 40.38 | ![]() |
35.48 | ![]() | |||
Smarca5 | MY | Medulla | 48.1 | ![]() |
49.57 | ![]() | |||
Smarca5 | OLF | Olfactory bulb | 49.99 | ![]() |
41.36 | ![]() | |||
Smarca5 | P | Pons | 38.43 | ![]() |
39.98 | ![]() | |||
Smarca5 | PAL | Pallidum | 32.17 | ![]() |
27.97 | ![]() | |||
Smarca5 | RHP | Retrohippocampal region | 46.29 | ![]() |
37.92 | ![]() | |||
Smarca5 | sAMY | Striatum-like amygdalar nuclei | 32.78 | ![]() |
23.89 | ![]() | |||
Smarca5 | STR | Striatum | 32.05 | ![]() |
22.99 | ![]() | |||
Smarca5 | STRd | Striatum dorsal region | 29.96 | ![]() |
21.64 | ![]() | |||
Smarca5 | STRv | Striatum ventral region | 37.34 | ![]() |
25.44 | ![]() | |||
Smarca5 | TH | Thalamus | 32.48 | ![]() |
29.8 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00001221 | 9 | 891 | 899 | CNELQDIEK | Peptide Atlas |
SMCA5_HUMAN_227 | 12 | 227 | 238 | NIPGPHMVLVPK | PRIDE |
SMCA5_HUMAN_35 | 35 | 35 | 69 | GGPEGVAAQAVASAASAGPADAEMEEIFDDASPGK | PRIDE |
SMCA5_HUMAN_750 | 9 | 750 | 758 | EALRVSEPK | PRIDE |
SMCA5_HUMAN_98 | 22 | 98 | 119 | QTELFAHFIQPAAQKTPTSPLK | PRIDE |