Annotation Detail for RUVBL1
Basic Information Top
| Gene Symbol: | RUVBL1 ( ECP54,INO80H,NMP238,PONTIN,Pontin52,RVB1,TIH1,TIP49,TIP49A ) |
|---|---|
| Gene Full Name: | RuvB-like 1 (E. coli) |
| Band: | 3q21.3 |
| Quick Links | Entrez ID:8607; OMIM: 603449; Uniprot ID:RUVB1_HUMAN; ENSEMBL ID: ENSG00000175792; HGNC ID: 10474 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.272822
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 8 / 70761 | 113 | |
| blastocyst | 9 / 62319 | 144 | |
| fetus | 56 / 564012 | 99 | |
| neonate | 0 / 31097 | 0 | |
| infant | 9 / 23620 | 381 | |
| juvenile | 29 / 55556 | 521 | |
| adult | 168 / 1939121 | 86 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 2 / 17475 | 114 | |
| breast (mammary gland) tumor | 7 / 94178 | 74 | |
| cervical tumor | 7 / 34366 | 203 | |
| chondrosarcoma | 6 / 82823 | 72 | |
| colorectal tumor | 26 / 114246 | 227 | |
| esophageal tumor | 8 / 17290 | 462 | |
| gastrointestinal tumor | 20 / 119369 | 167 | |
| germ cell tumor | 43 / 263845 | 162 | |
| glioma | 15 / 106883 | 140 | |
| head and neck tumor | 8 / 136302 | 58 | |
| kidney tumor | 9 / 68959 | 130 | |
| leukemia | 15 / 95842 | 156 | |
| liver tumor | 10 / 96359 | 103 | |
| lung tumor | 47 / 103127 | 455 | |
| lymphoma | 13 / 71755 | 181 | |
| non-neoplasia | 10 / 97250 | 102 | |
| normal | 264 / 3360307 | 78 | |
| ovarian tumor | 18 / 76682 | 234 | |
| pancreatic tumor | 11 / 104616 | 105 | |
| primitive neuroectodermal tumor of the CNS | 56 / 125680 | 445 | |
| prostate cancer | 19 / 102680 | 185 | |
| retinoblastoma | 14 / 46356 | 302 | |
| skin tumor | 40 / 124949 | 320 | |
| soft tissue/muscle tissue tumor | 17 / 125191 | 135 | |
| uterine tumor | 9 / 90257 | 99 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 2 / 13106 | 152 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 11 / 40015 | 274 | |
| bladder | 3 / 29757 | 100 | |
| blood | 18 / 123478 | 145 | |
| bone | 6 / 71655 | 83 | |
| bone marrow | 4 / 48801 | 81 | |
| brain | 110 / 1100989 | 99 | |
| cervix | 7 / 48171 | 145 | |
| connective tissue | 7 / 149255 | 46 | |
| ear | 1 / 16212 | 61 | |
| embryonic tissue | 29 / 215722 | 134 | |
| esophagus | 8 / 20209 | 395 | |
| eye | 33 / 211054 | 156 | |
| heart | 6 / 89626 | 66 | |
| intestine | 34 / 234472 | 145 | |
| kidney | 18 / 211777 | 84 | |
| larynx | 0 / 24145 | 0 | |
| liver | 13 / 207743 | 62 | |
| lung | 66 / 336974 | 195 | |
| lymph | 4 / 44270 | 90 | |
| lymph node | 7 / 91610 | 76 | |
| mammary gland | 9 / 153271 | 58 | |
| mouth | 3 / 67052 | 44 | |
| muscle | 9 / 107715 | 83 | |
| nerve | 2 / 15768 | 126 | |
| ovary | 27 / 102051 | 264 | |
| pancreas | 17 / 214812 | 79 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 6 / 41328 | 145 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 28 / 280825 | 99 | |
| prostate | 25 / 189345 | 132 | |
| salivary gland | 1 / 20155 | 49 | |
| skin | 42 / 210574 | 199 | |
| spleen | 4 / 53952 | 74 | |
| stomach | 7 / 96619 | 72 | |
| testis | 36 / 330442 | 108 | |
| thymus | 8 / 81131 | 98 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 5 / 16999 | 294 | |
| trachea | 2 / 52413 | 38 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 19 / 232878 | 81 | |
| vascular | 1 / 51780 | 19 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201614_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 186.2 | |
| Adipocyte | 24.55 | |
| AdrenalCortex | 27.95 | |
| Adrenalgland | 21.65 | |
| Amygdala | 18.5 | |
| Appendix | 27.55 | |
| AtrioventricularNode | 21.9 | |
| BDCA4+_DentriticCells | 60.4 | |
| Bonemarrow | 27.35 | |
| BronchialEpithelialCells | 116.25 | |
| CD105+_Endothelial | 103.7 | |
| CD14+_Monocytes | 22.45 | |
| CD19+_BCells(neg._sel.) | 34.95 | |
| CD33+_Myeloid | 31.4 | |
| CD34+ | 119.95 | |
| CD4+_Tcells | 34.05 | |
| CD56+_NKCells | 48.9 | |
| CD71+_EarlyErythroid | 18.75 | |
| CD8+_Tcells | 19.9 | |
| CardiacMyocytes | 33.45 | |
| Caudatenucleus | 18.75 | |
| Cerebellum | 20.25 | |
| CerebellumPeduncles | 28.8 | |
| CiliaryGanglion | 20.05 | |
| CingulateCortex | 22.95 | |
| Colorectaladenocarcinoma | 65.75 | |
| DorsalRootGanglion | 20.4 | |
| FetalThyroid | 24.35 | |
| Fetalbrain | 24.2 | |
| Fetalliver | 21.85 | |
| Fetallung | 22.7 | |
| GlobusPallidus | 17.1 | |
| Heart | 35.15 | |
| Hypothalamus | 19.3 | |
| Kidney | 23.75 | |
| Leukemia_chronicMyelogenousK-562 | 71.95 | |
| Leukemia_promyelocytic-HL-60 | 165.7 | |
| Leukemialymphoblastic(MOLT-4) | 71.1 | |
| Liver | 41.95 | |
| Lung | 39.05 | |
| Lymphnode | 20.4 | |
| Lymphoma_burkitts(Daudi) | 121.25 | |
| Lymphoma_burkitts(Raji) | 226.85 | |
| MedullaOblongata | 21.3 | |
| OccipitalLobe | 14.35 | |
| OlfactoryBulb | 19.3 | |
| Ovary | 17.7 | |
| Pancreas | 20.65 | |
| PancreaticIslet | 31.25 | |
| ParietalLobe | 27.2 | |
| Pituitary | 28.65 | |
| Placenta | 22.2 | |
| Pons | 21.9 | |
| PrefrontalCortex | 16.35 | |
| Prostate | 28.5 | |
| Salivarygland | 19.45 | |
| SkeletalMuscle | 32.05 | |
| Skin | 21.75 | |
| SmoothMuscle | 32.2 | |
| Spinalcord | 21.9 | |
| SubthalamicNucleus | 23.2 | |
| SuperiorCervicalGanglion | 34.7 | |
| TemporalLobe | 18.5 | |
| Testis | 46.75 | |
| TestisGermCell | 28.9 | |
| TestisIntersitial | 21.75 | |
| TestisLeydigCell | 25.4 | |
| TestisSeminiferousTubule | 24 | |
| Thalamus | 18.85 | |
| Thymus | 46.45 | |
| Thyroid | 32.25 | |
| Tongue | 25.4 | |
| Tonsil | 24.6 | |
| Trachea | 20.9 | |
| TrigeminalGanglion | 26.4 | |
| Uterus | 19.1 | |
| UterusCorpus | 23.15 | |
| WholeBlood | 23.5 | |
| Wholebrain | 22.85 | |
| colon | 19.75 | |
| pineal_day | 26.12 | |
| pineal_night | 28.42 | |
| retina | 23.475 | |
| small_intestine | 22.9 |
- Probe name: A_32_P30693
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 5.84 ± 0.46 | |
| Basal Forebrain | 5.46 ± 0.26 | |
| Basal Part of Pons | 5.61 ± 0.43 | |
| Cerebellar Cortex | 5.37 ± 0.31 | |
| Cerebellar Nuclei | 5.72 ± 0.31 | |
| Claustrum | 5.6 ± 0.48 | |
| Epithalamus | 6.28 ± 0.56 | |
| Frontal Lobe | 5.46 ± 0.46 | |
| Globus Pallidus | 5.8 ± 0.45 | |
| Hypothalamus | 5.59 ± 0.36 | |
| Insula | 5.38 ± 0.43 | |
| Limbic Lobe | 5.72 ± 0.37 | |
| Mesencephalon | 5.53 ± 0.67 | |
| Myelencephalon | 5.63 ± 0.47 | |
| Occipital Lobe | 5.85 ± 0.47 | |
| Parietal Lobe | 5.57 ± 0.37 | |
| Pontine Tegmentum | 5.56 ± 0.46 | |
| Striatum | 6.18 ± 0.38 | |
| Subthalamus | 5.09 ± 0.34 | |
| Temporal Lobe | 5.55 ± 0.46 | |
| Thalamus | 5.45 ± 0.4 | |
| White Matter | 5.43 ± 0.42 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Ruvbl1 | CB | Cerebellum | 14.39 | |
| 17.67 | ||||
| Ruvbl1 | CTX | Cerebral cortex | 25.49 | |
| 19.43 | ||||
| Ruvbl1 | HIP | Hippocampal region | 25.94 | |
| 36.92 | ||||
| Ruvbl1 | HPF | Hippocampal formation | 27.9 | |
| 31.91 | ||||
| Ruvbl1 | HY | Hypothalamus | 5.47 | |
| 4.37 | ||||
| Ruvbl1 | LSX | Lateral septal complex | 11.65 | |
| 9.05 | ||||
| Ruvbl1 | MB | Midbrain | 11.18 | |
| 11.05 | ||||
| Ruvbl1 | MY | Medulla | 21.58 | |
| 26.62 | ||||
| Ruvbl1 | OLF | Olfactory bulb | 19.39 | |
| 15.38 | ||||
| Ruvbl1 | P | Pons | 15.5 | |
| 18.35 | ||||
| Ruvbl1 | PAL | Pallidum | 9.95 | |
| 9.96 | ||||
| Ruvbl1 | RHP | Retrohippocampal region | 32.23 | |
| 25.87 | ||||
| Ruvbl1 | sAMY | Striatum-like amygdalar nuclei | 13.16 | |
| 9.15 | ||||
| Ruvbl1 | STR | Striatum | 13.94 | |
| 9.92 | ||||
| Ruvbl1 | STRd | Striatum dorsal region | 14.54 | |
| 10.58 | ||||
| Ruvbl1 | STRv | Striatum ventral region | 14.38 | |
| 9.33 | ||||
| Ruvbl1 | TH | Thalamus | 9.28 | |
| 7.97 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00000911 | 20 | 206 | 225 | CDTYATEFDLEAEEYVPLPK | Peptide Atlas |
| RUVB1_HUMAN_1 | 14 | 1 | 14 | MKIEEVKSTTKTQR | PRIDE |
| RUVB1_HUMAN_108 | 10 | 108 | 117 | KTEVLMENFR | PRIDE |
| RUVB1_HUMAN_232 | 35 | 232 | 266 | EIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPK | PRIDE |
| RUVB1_HUMAN_317 | 16 | 317 | 332 | ALESSIAPIVIFASNR | PRIDE |
| RUVB1_HUMAN_339 | 18 | 339 | 356 | GTEDITSPHGIPLDLLDR | PRIDE |
| RUVB1_HUMAN_339 | 23 | 339 | 361 | GTEDITSPHGIPLDLLDRVMIIR | PRIDE |
| RUVB1_HUMAN_404 | 14 | 404 | 417 | YSVQLLTPANLLAK | PRIDE |
| RUVB1_HUMAN_46 | 11 | 46 | 56 | EACGVIVELIK | PRIDE |



