Annotation Detail for RUVBL1


Gene Symbol: | RUVBL1 ( ECP54,INO80H,NMP238,PONTIN,Pontin52,RVB1,TIH1,TIP49,TIP49A ) |
---|---|
Gene Full Name: | RuvB-like 1 (E. coli) |
Band: | 3q21.3 |
Quick Links | Entrez ID:8607; OMIM: 603449; Uniprot ID:RUVB1_HUMAN; ENSEMBL ID: ENSG00000175792; HGNC ID: 10474 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.272822
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 8 / 70761 | 113 | ![]() |
blastocyst | 9 / 62319 | 144 | ![]() |
fetus | 56 / 564012 | 99 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 9 / 23620 | 381 | ![]() |
juvenile | 29 / 55556 | 521 | ![]() |
adult | 168 / 1939121 | 86 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 2 / 17475 | 114 | ![]() |
breast (mammary gland) tumor | 7 / 94178 | 74 | ![]() |
cervical tumor | 7 / 34366 | 203 | ![]() |
chondrosarcoma | 6 / 82823 | 72 | ![]() |
colorectal tumor | 26 / 114246 | 227 | ![]() |
esophageal tumor | 8 / 17290 | 462 | ![]() |
gastrointestinal tumor | 20 / 119369 | 167 | ![]() |
germ cell tumor | 43 / 263845 | 162 | ![]() |
glioma | 15 / 106883 | 140 | ![]() |
head and neck tumor | 8 / 136302 | 58 | ![]() |
kidney tumor | 9 / 68959 | 130 | ![]() |
leukemia | 15 / 95842 | 156 | ![]() |
liver tumor | 10 / 96359 | 103 | ![]() |
lung tumor | 47 / 103127 | 455 | ![]() |
lymphoma | 13 / 71755 | 181 | ![]() |
non-neoplasia | 10 / 97250 | 102 | ![]() |
normal | 264 / 3360307 | 78 | ![]() |
ovarian tumor | 18 / 76682 | 234 | ![]() |
pancreatic tumor | 11 / 104616 | 105 | ![]() |
primitive neuroectodermal tumor of the CNS | 56 / 125680 | 445 | ![]() |
prostate cancer | 19 / 102680 | 185 | ![]() |
retinoblastoma | 14 / 46356 | 302 | ![]() |
skin tumor | 40 / 124949 | 320 | ![]() |
soft tissue/muscle tissue tumor | 17 / 125191 | 135 | ![]() |
uterine tumor | 9 / 90257 | 99 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 2 / 13106 | 152 | ![]() |
adrenal gland | 0 / 33197 | 0 | |
ascites | 11 / 40015 | 274 | ![]() |
bladder | 3 / 29757 | 100 | ![]() |
blood | 18 / 123478 | 145 | ![]() |
bone | 6 / 71655 | 83 | ![]() |
bone marrow | 4 / 48801 | 81 | ![]() |
brain | 110 / 1100989 | 99 | ![]() |
cervix | 7 / 48171 | 145 | ![]() |
connective tissue | 7 / 149255 | 46 | ![]() |
ear | 1 / 16212 | 61 | ![]() |
embryonic tissue | 29 / 215722 | 134 | ![]() |
esophagus | 8 / 20209 | 395 | ![]() |
eye | 33 / 211054 | 156 | ![]() |
heart | 6 / 89626 | 66 | ![]() |
intestine | 34 / 234472 | 145 | ![]() |
kidney | 18 / 211777 | 84 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 13 / 207743 | 62 | ![]() |
lung | 66 / 336974 | 195 | ![]() |
lymph | 4 / 44270 | 90 | ![]() |
lymph node | 7 / 91610 | 76 | ![]() |
mammary gland | 9 / 153271 | 58 | ![]() |
mouth | 3 / 67052 | 44 | ![]() |
muscle | 9 / 107715 | 83 | ![]() |
nerve | 2 / 15768 | 126 | ![]() |
ovary | 27 / 102051 | 264 | ![]() |
pancreas | 17 / 214812 | 79 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 6 / 41328 | 145 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 28 / 280825 | 99 | ![]() |
prostate | 25 / 189345 | 132 | ![]() |
salivary gland | 1 / 20155 | 49 | ![]() |
skin | 42 / 210574 | 199 | ![]() |
spleen | 4 / 53952 | 74 | ![]() |
stomach | 7 / 96619 | 72 | ![]() |
testis | 36 / 330442 | 108 | ![]() |
thymus | 8 / 81131 | 98 | ![]() |
thyroid | 2 / 47473 | 42 | ![]() |
tonsil | 5 / 16999 | 294 | ![]() |
trachea | 2 / 52413 | 38 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 19 / 232878 | 81 | ![]() |
vascular | 1 / 51780 | 19 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201614_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 186.2 | ![]() |
Adipocyte | 24.55 | ![]() |
AdrenalCortex | 27.95 | ![]() |
Adrenalgland | 21.65 | ![]() |
Amygdala | 18.5 | ![]() |
Appendix | 27.55 | ![]() |
AtrioventricularNode | 21.9 | ![]() |
BDCA4+_DentriticCells | 60.4 | ![]() |
Bonemarrow | 27.35 | ![]() |
BronchialEpithelialCells | 116.25 | ![]() |
CD105+_Endothelial | 103.7 | ![]() |
CD14+_Monocytes | 22.45 | ![]() |
CD19+_BCells(neg._sel.) | 34.95 | ![]() |
CD33+_Myeloid | 31.4 | ![]() |
CD34+ | 119.95 | ![]() |
CD4+_Tcells | 34.05 | ![]() |
CD56+_NKCells | 48.9 | ![]() |
CD71+_EarlyErythroid | 18.75 | ![]() |
CD8+_Tcells | 19.9 | ![]() |
CardiacMyocytes | 33.45 | ![]() |
Caudatenucleus | 18.75 | ![]() |
Cerebellum | 20.25 | ![]() |
CerebellumPeduncles | 28.8 | ![]() |
CiliaryGanglion | 20.05 | ![]() |
CingulateCortex | 22.95 | ![]() |
Colorectaladenocarcinoma | 65.75 | ![]() |
DorsalRootGanglion | 20.4 | ![]() |
FetalThyroid | 24.35 | ![]() |
Fetalbrain | 24.2 | ![]() |
Fetalliver | 21.85 | ![]() |
Fetallung | 22.7 | ![]() |
GlobusPallidus | 17.1 | ![]() |
Heart | 35.15 | ![]() |
Hypothalamus | 19.3 | ![]() |
Kidney | 23.75 | ![]() |
Leukemia_chronicMyelogenousK-562 | 71.95 | ![]() |
Leukemia_promyelocytic-HL-60 | 165.7 | ![]() |
Leukemialymphoblastic(MOLT-4) | 71.1 | ![]() |
Liver | 41.95 | ![]() |
Lung | 39.05 | ![]() |
Lymphnode | 20.4 | ![]() |
Lymphoma_burkitts(Daudi) | 121.25 | ![]() |
Lymphoma_burkitts(Raji) | 226.85 | ![]() |
MedullaOblongata | 21.3 | ![]() |
OccipitalLobe | 14.35 | ![]() |
OlfactoryBulb | 19.3 | ![]() |
Ovary | 17.7 | ![]() |
Pancreas | 20.65 | ![]() |
PancreaticIslet | 31.25 | ![]() |
ParietalLobe | 27.2 | ![]() |
Pituitary | 28.65 | ![]() |
Placenta | 22.2 | ![]() |
Pons | 21.9 | ![]() |
PrefrontalCortex | 16.35 | ![]() |
Prostate | 28.5 | ![]() |
Salivarygland | 19.45 | ![]() |
SkeletalMuscle | 32.05 | ![]() |
Skin | 21.75 | ![]() |
SmoothMuscle | 32.2 | ![]() |
Spinalcord | 21.9 | ![]() |
SubthalamicNucleus | 23.2 | ![]() |
SuperiorCervicalGanglion | 34.7 | ![]() |
TemporalLobe | 18.5 | ![]() |
Testis | 46.75 | ![]() |
TestisGermCell | 28.9 | ![]() |
TestisIntersitial | 21.75 | ![]() |
TestisLeydigCell | 25.4 | ![]() |
TestisSeminiferousTubule | 24 | ![]() |
Thalamus | 18.85 | ![]() |
Thymus | 46.45 | ![]() |
Thyroid | 32.25 | ![]() |
Tongue | 25.4 | ![]() |
Tonsil | 24.6 | ![]() |
Trachea | 20.9 | ![]() |
TrigeminalGanglion | 26.4 | ![]() |
Uterus | 19.1 | ![]() |
UterusCorpus | 23.15 | ![]() |
WholeBlood | 23.5 | ![]() |
Wholebrain | 22.85 | ![]() |
colon | 19.75 | ![]() |
pineal_day | 26.12 | ![]() |
pineal_night | 28.42 | ![]() |
retina | 23.475 | ![]() |
small_intestine | 22.9 | ![]() |
- Probe name: A_32_P30693
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.84 ± 0.46 | ![]() ![]() ![]() |
Basal Forebrain | 5.46 ± 0.26 | ![]() ![]() ![]() |
Basal Part of Pons | 5.61 ± 0.43 | ![]() ![]() ![]() |
Cerebellar Cortex | 5.37 ± 0.31 | ![]() ![]() ![]() |
Cerebellar Nuclei | 5.72 ± 0.31 | ![]() ![]() ![]() |
Claustrum | 5.6 ± 0.48 | ![]() ![]() ![]() |
Epithalamus | 6.28 ± 0.56 | ![]() ![]() ![]() |
Frontal Lobe | 5.46 ± 0.46 | ![]() ![]() ![]() |
Globus Pallidus | 5.8 ± 0.45 | ![]() ![]() ![]() |
Hypothalamus | 5.59 ± 0.36 | ![]() ![]() ![]() |
Insula | 5.38 ± 0.43 | ![]() ![]() ![]() |
Limbic Lobe | 5.72 ± 0.37 | ![]() ![]() ![]() |
Mesencephalon | 5.53 ± 0.67 | ![]() ![]() ![]() |
Myelencephalon | 5.63 ± 0.47 | ![]() ![]() ![]() |
Occipital Lobe | 5.85 ± 0.47 | ![]() ![]() ![]() |
Parietal Lobe | 5.57 ± 0.37 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.56 ± 0.46 | ![]() ![]() ![]() |
Striatum | 6.18 ± 0.38 | ![]() ![]() ![]() |
Subthalamus | 5.09 ± 0.34 | ![]() ![]() ![]() |
Temporal Lobe | 5.55 ± 0.46 | ![]() ![]() ![]() |
Thalamus | 5.45 ± 0.4 | ![]() ![]() ![]() |
White Matter | 5.43 ± 0.42 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Ruvbl1 | CB | Cerebellum | 14.39 | ![]() |
17.67 | ![]() | |||
Ruvbl1 | CTX | Cerebral cortex | 25.49 | ![]() |
19.43 | ![]() | |||
Ruvbl1 | HIP | Hippocampal region | 25.94 | ![]() |
36.92 | ![]() | |||
Ruvbl1 | HPF | Hippocampal formation | 27.9 | ![]() |
31.91 | ![]() | |||
Ruvbl1 | HY | Hypothalamus | 5.47 | ![]() |
4.37 | ![]() | |||
Ruvbl1 | LSX | Lateral septal complex | 11.65 | ![]() |
9.05 | ![]() | |||
Ruvbl1 | MB | Midbrain | 11.18 | ![]() |
11.05 | ![]() | |||
Ruvbl1 | MY | Medulla | 21.58 | ![]() |
26.62 | ![]() | |||
Ruvbl1 | OLF | Olfactory bulb | 19.39 | ![]() |
15.38 | ![]() | |||
Ruvbl1 | P | Pons | 15.5 | ![]() |
18.35 | ![]() | |||
Ruvbl1 | PAL | Pallidum | 9.95 | ![]() |
9.96 | ![]() | |||
Ruvbl1 | RHP | Retrohippocampal region | 32.23 | ![]() |
25.87 | ![]() | |||
Ruvbl1 | sAMY | Striatum-like amygdalar nuclei | 13.16 | ![]() |
9.15 | ![]() | |||
Ruvbl1 | STR | Striatum | 13.94 | ![]() |
9.92 | ![]() | |||
Ruvbl1 | STRd | Striatum dorsal region | 14.54 | ![]() |
10.58 | ![]() | |||
Ruvbl1 | STRv | Striatum ventral region | 14.38 | ![]() |
9.33 | ![]() | |||
Ruvbl1 | TH | Thalamus | 9.28 | ![]() |
7.97 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00000911 | 20 | 206 | 225 | CDTYATEFDLEAEEYVPLPK | Peptide Atlas |
RUVB1_HUMAN_1 | 14 | 1 | 14 | MKIEEVKSTTKTQR | PRIDE |
RUVB1_HUMAN_108 | 10 | 108 | 117 | KTEVLMENFR | PRIDE |
RUVB1_HUMAN_232 | 35 | 232 | 266 | EIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPK | PRIDE |
RUVB1_HUMAN_317 | 16 | 317 | 332 | ALESSIAPIVIFASNR | PRIDE |
RUVB1_HUMAN_339 | 18 | 339 | 356 | GTEDITSPHGIPLDLLDR | PRIDE |
RUVB1_HUMAN_339 | 23 | 339 | 361 | GTEDITSPHGIPLDLLDRVMIIR | PRIDE |
RUVB1_HUMAN_404 | 14 | 404 | 417 | YSVQLLTPANLLAK | PRIDE |
RUVB1_HUMAN_46 | 11 | 46 | 56 | EACGVIVELIK | PRIDE |