Annotation Detail for ASMTL
Basic Information Top
| Gene Symbol: | ASMTL ( ASMTLX,ASMTLY,ASTML ) |
|---|---|
| Gene Full Name: | acetylserotonin O-methyltransferase-like |
| Band: | Xp22.3 and Yp11.3 |
| Quick Links | Entrez ID:8623; OMIM: 300162,400011; Uniprot ID:ASML_HUMAN; ENSEMBL ID: ENSG00000169093; HGNC ID: 751 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.533514
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 2 / 70761 | 28 | |
| blastocyst | 5 / 62319 | 80 | |
| fetus | 16 / 564012 | 28 | |
| neonate | 4 / 31097 | 128 | |
| infant | 2 / 23620 | 84 | |
| juvenile | 6 / 55556 | 107 | |
| adult | 119 / 1939121 | 61 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 4 / 94178 | 42 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 9 / 82823 | 108 | |
| colorectal tumor | 3 / 114246 | 26 | |
| esophageal tumor | 1 / 17290 | 57 | |
| gastrointestinal tumor | 16 / 119369 | 134 | |
| germ cell tumor | 25 / 263845 | 94 | |
| glioma | 9 / 106883 | 84 | |
| head and neck tumor | 4 / 136302 | 29 | |
| kidney tumor | 8 / 68959 | 116 | |
| leukemia | 15 / 95842 | 156 | |
| liver tumor | 5 / 96359 | 51 | |
| lung tumor | 4 / 103127 | 38 | |
| lymphoma | 5 / 71755 | 69 | |
| non-neoplasia | 9 / 97250 | 92 | |
| normal | 223 / 3360307 | 66 | |
| ovarian tumor | 11 / 76682 | 143 | |
| pancreatic tumor | 5 / 104616 | 47 | |
| primitive neuroectodermal tumor of the CNS | 18 / 125680 | 143 | |
| prostate cancer | 4 / 102680 | 38 | |
| retinoblastoma | 2 / 46356 | 43 | |
| skin tumor | 2 / 124949 | 16 | |
| soft tissue/muscle tissue tumor | 8 / 125191 | 63 | |
| uterine tumor | 7 / 90257 | 77 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 6 / 33197 | 180 | |
| ascites | 13 / 40015 | 324 | |
| bladder | 2 / 29757 | 67 | |
| blood | 16 / 123478 | 129 | |
| bone | 5 / 71655 | 69 | |
| bone marrow | 10 / 48801 | 204 | |
| brain | 86 / 1100989 | 78 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 14 / 149255 | 93 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 9 / 215722 | 41 | |
| esophagus | 1 / 20209 | 49 | |
| eye | 15 / 211054 | 71 | |
| heart | 11 / 89626 | 122 | |
| intestine | 13 / 234472 | 55 | |
| kidney | 21 / 211777 | 99 | |
| larynx | 1 / 24145 | 41 | |
| liver | 9 / 207743 | 43 | |
| lung | 18 / 336974 | 53 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 1 / 91610 | 10 | |
| mammary gland | 8 / 153271 | 52 | |
| mouth | 3 / 67052 | 44 | |
| muscle | 9 / 107715 | 83 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 17 / 102051 | 166 | |
| pancreas | 14 / 214812 | 65 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 2 / 16585 | 120 | |
| placenta | 10 / 280825 | 35 | |
| prostate | 15 / 189345 | 79 | |
| salivary gland | 1 / 20155 | 49 | |
| skin | 6 / 210574 | 28 | |
| spleen | 7 / 53952 | 129 | |
| stomach | 3 / 96619 | 31 | |
| testis | 15 / 330442 | 45 | |
| thymus | 17 / 81131 | 209 | |
| thyroid | 3 / 47473 | 63 | |
| tonsil | 6 / 16999 | 352 | |
| trachea | 3 / 52413 | 57 | |
| umbilical cord | 1 / 13680 | 73 | |
| uterus | 18 / 232878 | 77 | |
| vascular | 4 / 51780 | 77 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 36554_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 116.75 | |
| Adipocyte | 16.6 | |
| AdrenalCortex | 30.3 | |
| Adrenalgland | 19.85 | |
| Amygdala | 54.4 | |
| Appendix | 25.1 | |
| AtrioventricularNode | 19.35 | |
| BDCA4+_DentriticCells | 130.3 | |
| Bonemarrow | 31.75 | |
| BronchialEpithelialCells | 22.1 | |
| CD105+_Endothelial | 29.4 | |
| CD14+_Monocytes | 29.35 | |
| CD19+_BCells(neg._sel.) | 53 | |
| CD33+_Myeloid | 44.75 | |
| CD34+ | 68.05 | |
| CD4+_Tcells | 39.15 | |
| CD56+_NKCells | 145.85 | |
| CD71+_EarlyErythroid | 45.2 | |
| CD8+_Tcells | 43.3 | |
| CardiacMyocytes | 33.45 | |
| Caudatenucleus | 18.7 | |
| Cerebellum | 20 | |
| CerebellumPeduncles | 26.55 | |
| CiliaryGanglion | 18.7 | |
| CingulateCortex | 25.45 | |
| Colorectaladenocarcinoma | 28 | |
| DorsalRootGanglion | 18.95 | |
| FetalThyroid | 27.45 | |
| Fetalbrain | 21.1 | |
| Fetalliver | 29 | |
| Fetallung | 23.85 | |
| GlobusPallidus | 17.6 | |
| Heart | 101.65 | |
| Hypothalamus | 30.95 | |
| Kidney | 20.65 | |
| Leukemia_chronicMyelogenousK-562 | 19.5 | |
| Leukemia_promyelocytic-HL-60 | 149 | |
| Leukemialymphoblastic(MOLT-4) | 26.25 | |
| Liver | 282 | |
| Lung | 123.2 | |
| Lymphnode | 23.95 | |
| Lymphoma_burkitts(Daudi) | 25.9 | |
| Lymphoma_burkitts(Raji) | 234.4 | |
| MedullaOblongata | 21.2 | |
| OccipitalLobe | 18.1 | |
| OlfactoryBulb | 18.55 | |
| Ovary | 16.15 | |
| Pancreas | 16.1 | |
| PancreaticIslet | 19.4 | |
| ParietalLobe | 25.05 | |
| Pituitary | 33.5 | |
| Placenta | 25 | |
| Pons | 21.15 | |
| PrefrontalCortex | 34 | |
| Prostate | 137.85 | |
| Salivarygland | 19.2 | |
| SkeletalMuscle | 38.55 | |
| Skin | 19.15 | |
| SmoothMuscle | 26.15 | |
| Spinalcord | 29.1 | |
| SubthalamicNucleus | 22.4 | |
| SuperiorCervicalGanglion | 35.55 | |
| TemporalLobe | 31.65 | |
| Testis | 16.5 | |
| TestisGermCell | 17.2 | |
| TestisIntersitial | 16.45 | |
| TestisLeydigCell | 20.95 | |
| TestisSeminiferousTubule | 18.75 | |
| Thalamus | 22.3 | |
| Thymus | 39.5 | |
| Thyroid | 265.7 | |
| Tongue | 21.45 | |
| Tonsil | 22.1 | |
| Trachea | 18.1 | |
| TrigeminalGanglion | 33.5 | |
| Uterus | 27.75 | |
| UterusCorpus | 27.25 | |
| WholeBlood | 58.9 | |
| Wholebrain | 63.95 | |
| colon | 20.2 | |
| pineal_day | 71.88 | |
| pineal_night | 73.84 | |
| retina | 84.05 | |
| small_intestine | 18.35 |
- Probe name: A_23_P159544
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 4.52 ± 0.55 | |
| Basal Forebrain | 4.59 ± 0.46 | |
| Basal Part of Pons | 5.19 ± 0.55 | |
| Cerebellar Cortex | 5.2 ± 0.49 | |
| Cerebellar Nuclei | 4.38 ± 0.33 | |
| Claustrum | 4 ± 0.78 | |
| Epithalamus | 5.04 ± 0.6 | |
| Frontal Lobe | 4.97 ± 0.53 | |
| Globus Pallidus | 4.54 ± 0.24 | |
| Hypothalamus | 4.83 ± 0.61 | |
| Insula | 5 ± 0.44 | |
| Limbic Lobe | 4.55 ± 0.67 | |
| Mesencephalon | 4.72 ± 0.49 | |
| Myelencephalon | 4.72 ± 0.65 | |
| Occipital Lobe | 4.31 ± 0.56 | |
| Parietal Lobe | 4.65 ± 0.63 | |
| Pontine Tegmentum | 4.65 ± 0.59 | |
| Striatum | 4.22 ± 0.48 | |
| Subthalamus | 5.24 ± 0.61 | |
| Temporal Lobe | 4.86 ± 0.54 | |
| Thalamus | 4.9 ± 0.5 | |
| White Matter | 5.07 ± 0.62 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| ASML_HUMAN_172 | 34 | 172 | 205 | AGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCK | PRIDE |
| ASML_HUMAN_251 | 25 | 251 | 275 | DAGSRDEKAEAGEAGQATAEAECHR | PRIDE |
| ASML_HUMAN_287 | 12 | 287 | 298 | LLELIEGFMLSK | PRIDE |
| ASML_HUMAN_541 | 23 | 541 | 563 | VAESCKPGAGLLLVETLLDEEKR | PRIDE |
| PAp00000276 | 17 | 260 | 276 | AEAGEAGQATAEAECHR | Peptide Atlas |




Mouse Brain ISH