Annotation Detail for ASMTL


Gene Symbol: | ASMTL ( ASMTLX,ASMTLY,ASTML ) |
---|---|
Gene Full Name: | acetylserotonin O-methyltransferase-like |
Band: | Xp22.3 and Yp11.3 |
Quick Links | Entrez ID:8623; OMIM: 300162,400011; Uniprot ID:ASML_HUMAN; ENSEMBL ID: ENSG00000169093; HGNC ID: 751 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.533514
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 2 / 70761 | 28 | ![]() |
blastocyst | 5 / 62319 | 80 | ![]() |
fetus | 16 / 564012 | 28 | ![]() |
neonate | 4 / 31097 | 128 | ![]() |
infant | 2 / 23620 | 84 | ![]() |
juvenile | 6 / 55556 | 107 | ![]() |
adult | 119 / 1939121 | 61 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 4 / 94178 | 42 | ![]() |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 9 / 82823 | 108 | ![]() |
colorectal tumor | 3 / 114246 | 26 | ![]() |
esophageal tumor | 1 / 17290 | 57 | ![]() |
gastrointestinal tumor | 16 / 119369 | 134 | ![]() |
germ cell tumor | 25 / 263845 | 94 | ![]() |
glioma | 9 / 106883 | 84 | ![]() |
head and neck tumor | 4 / 136302 | 29 | ![]() |
kidney tumor | 8 / 68959 | 116 | ![]() |
leukemia | 15 / 95842 | 156 | ![]() |
liver tumor | 5 / 96359 | 51 | ![]() |
lung tumor | 4 / 103127 | 38 | ![]() |
lymphoma | 5 / 71755 | 69 | ![]() |
non-neoplasia | 9 / 97250 | 92 | ![]() |
normal | 223 / 3360307 | 66 | ![]() |
ovarian tumor | 11 / 76682 | 143 | ![]() |
pancreatic tumor | 5 / 104616 | 47 | ![]() |
primitive neuroectodermal tumor of the CNS | 18 / 125680 | 143 | ![]() |
prostate cancer | 4 / 102680 | 38 | ![]() |
retinoblastoma | 2 / 46356 | 43 | ![]() |
skin tumor | 2 / 124949 | 16 | ![]() |
soft tissue/muscle tissue tumor | 8 / 125191 | 63 | ![]() |
uterine tumor | 7 / 90257 | 77 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 6 / 33197 | 180 | ![]() |
ascites | 13 / 40015 | 324 | ![]() |
bladder | 2 / 29757 | 67 | ![]() |
blood | 16 / 123478 | 129 | ![]() |
bone | 5 / 71655 | 69 | ![]() |
bone marrow | 10 / 48801 | 204 | ![]() |
brain | 86 / 1100989 | 78 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 14 / 149255 | 93 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 9 / 215722 | 41 | ![]() |
esophagus | 1 / 20209 | 49 | ![]() |
eye | 15 / 211054 | 71 | ![]() |
heart | 11 / 89626 | 122 | ![]() |
intestine | 13 / 234472 | 55 | ![]() |
kidney | 21 / 211777 | 99 | ![]() |
larynx | 1 / 24145 | 41 | ![]() |
liver | 9 / 207743 | 43 | ![]() |
lung | 18 / 336974 | 53 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 1 / 91610 | 10 | ![]() |
mammary gland | 8 / 153271 | 52 | ![]() |
mouth | 3 / 67052 | 44 | ![]() |
muscle | 9 / 107715 | 83 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 17 / 102051 | 166 | ![]() |
pancreas | 14 / 214812 | 65 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 2 / 16585 | 120 | ![]() |
placenta | 10 / 280825 | 35 | ![]() |
prostate | 15 / 189345 | 79 | ![]() |
salivary gland | 1 / 20155 | 49 | ![]() |
skin | 6 / 210574 | 28 | ![]() |
spleen | 7 / 53952 | 129 | ![]() |
stomach | 3 / 96619 | 31 | ![]() |
testis | 15 / 330442 | 45 | ![]() |
thymus | 17 / 81131 | 209 | ![]() |
thyroid | 3 / 47473 | 63 | ![]() |
tonsil | 6 / 16999 | 352 | ![]() |
trachea | 3 / 52413 | 57 | ![]() |
umbilical cord | 1 / 13680 | 73 | ![]() |
uterus | 18 / 232878 | 77 | ![]() |
vascular | 4 / 51780 | 77 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 36554_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 116.75 | ![]() |
Adipocyte | 16.6 | ![]() |
AdrenalCortex | 30.3 | ![]() |
Adrenalgland | 19.85 | ![]() |
Amygdala | 54.4 | ![]() |
Appendix | 25.1 | ![]() |
AtrioventricularNode | 19.35 | ![]() |
BDCA4+_DentriticCells | 130.3 | ![]() |
Bonemarrow | 31.75 | ![]() |
BronchialEpithelialCells | 22.1 | ![]() |
CD105+_Endothelial | 29.4 | ![]() |
CD14+_Monocytes | 29.35 | ![]() |
CD19+_BCells(neg._sel.) | 53 | ![]() |
CD33+_Myeloid | 44.75 | ![]() |
CD34+ | 68.05 | ![]() |
CD4+_Tcells | 39.15 | ![]() |
CD56+_NKCells | 145.85 | ![]() |
CD71+_EarlyErythroid | 45.2 | ![]() |
CD8+_Tcells | 43.3 | ![]() |
CardiacMyocytes | 33.45 | ![]() |
Caudatenucleus | 18.7 | ![]() |
Cerebellum | 20 | ![]() |
CerebellumPeduncles | 26.55 | ![]() |
CiliaryGanglion | 18.7 | ![]() |
CingulateCortex | 25.45 | ![]() |
Colorectaladenocarcinoma | 28 | ![]() |
DorsalRootGanglion | 18.95 | ![]() |
FetalThyroid | 27.45 | ![]() |
Fetalbrain | 21.1 | ![]() |
Fetalliver | 29 | ![]() |
Fetallung | 23.85 | ![]() |
GlobusPallidus | 17.6 | ![]() |
Heart | 101.65 | ![]() |
Hypothalamus | 30.95 | ![]() |
Kidney | 20.65 | ![]() |
Leukemia_chronicMyelogenousK-562 | 19.5 | ![]() |
Leukemia_promyelocytic-HL-60 | 149 | ![]() |
Leukemialymphoblastic(MOLT-4) | 26.25 | ![]() |
Liver | 282 | ![]() |
Lung | 123.2 | ![]() |
Lymphnode | 23.95 | ![]() |
Lymphoma_burkitts(Daudi) | 25.9 | ![]() |
Lymphoma_burkitts(Raji) | 234.4 | ![]() |
MedullaOblongata | 21.2 | ![]() |
OccipitalLobe | 18.1 | ![]() |
OlfactoryBulb | 18.55 | ![]() |
Ovary | 16.15 | ![]() |
Pancreas | 16.1 | ![]() |
PancreaticIslet | 19.4 | ![]() |
ParietalLobe | 25.05 | ![]() |
Pituitary | 33.5 | ![]() |
Placenta | 25 | ![]() |
Pons | 21.15 | ![]() |
PrefrontalCortex | 34 | ![]() |
Prostate | 137.85 | ![]() |
Salivarygland | 19.2 | ![]() |
SkeletalMuscle | 38.55 | ![]() |
Skin | 19.15 | ![]() |
SmoothMuscle | 26.15 | ![]() |
Spinalcord | 29.1 | ![]() |
SubthalamicNucleus | 22.4 | ![]() |
SuperiorCervicalGanglion | 35.55 | ![]() |
TemporalLobe | 31.65 | ![]() |
Testis | 16.5 | ![]() |
TestisGermCell | 17.2 | ![]() |
TestisIntersitial | 16.45 | ![]() |
TestisLeydigCell | 20.95 | ![]() |
TestisSeminiferousTubule | 18.75 | ![]() |
Thalamus | 22.3 | ![]() |
Thymus | 39.5 | ![]() |
Thyroid | 265.7 | ![]() |
Tongue | 21.45 | ![]() |
Tonsil | 22.1 | ![]() |
Trachea | 18.1 | ![]() |
TrigeminalGanglion | 33.5 | ![]() |
Uterus | 27.75 | ![]() |
UterusCorpus | 27.25 | ![]() |
WholeBlood | 58.9 | ![]() |
Wholebrain | 63.95 | ![]() |
colon | 20.2 | ![]() |
pineal_day | 71.88 | ![]() |
pineal_night | 73.84 | ![]() |
retina | 84.05 | ![]() |
small_intestine | 18.35 | ![]() |
- Probe name: A_23_P159544
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 4.52 ± 0.55 | ![]() ![]() ![]() |
Basal Forebrain | 4.59 ± 0.46 | ![]() ![]() ![]() |
Basal Part of Pons | 5.19 ± 0.55 | ![]() ![]() ![]() |
Cerebellar Cortex | 5.2 ± 0.49 | ![]() ![]() ![]() |
Cerebellar Nuclei | 4.38 ± 0.33 | ![]() ![]() ![]() |
Claustrum | 4 ± 0.78 | ![]() ![]() ![]() |
Epithalamus | 5.04 ± 0.6 | ![]() ![]() ![]() |
Frontal Lobe | 4.97 ± 0.53 | ![]() ![]() ![]() |
Globus Pallidus | 4.54 ± 0.24 | ![]() ![]() ![]() |
Hypothalamus | 4.83 ± 0.61 | ![]() ![]() ![]() |
Insula | 5 ± 0.44 | ![]() ![]() ![]() |
Limbic Lobe | 4.55 ± 0.67 | ![]() ![]() ![]() |
Mesencephalon | 4.72 ± 0.49 | ![]() ![]() ![]() |
Myelencephalon | 4.72 ± 0.65 | ![]() ![]() ![]() |
Occipital Lobe | 4.31 ± 0.56 | ![]() ![]() ![]() |
Parietal Lobe | 4.65 ± 0.63 | ![]() ![]() ![]() |
Pontine Tegmentum | 4.65 ± 0.59 | ![]() ![]() ![]() |
Striatum | 4.22 ± 0.48 | ![]() ![]() ![]() |
Subthalamus | 5.24 ± 0.61 | ![]() ![]() ![]() |
Temporal Lobe | 4.86 ± 0.54 | ![]() ![]() ![]() |
Thalamus | 4.9 ± 0.5 | ![]() ![]() ![]() |
White Matter | 5.07 ± 0.62 | ![]() ![]() ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
ASML_HUMAN_172 | 34 | 172 | 205 | AGGYGIQALGGMLVESVHGDFLNVVGFPLNHFCK | PRIDE |
ASML_HUMAN_251 | 25 | 251 | 275 | DAGSRDEKAEAGEAGQATAEAECHR | PRIDE |
ASML_HUMAN_287 | 12 | 287 | 298 | LLELIEGFMLSK | PRIDE |
ASML_HUMAN_541 | 23 | 541 | 563 | VAESCKPGAGLLLVETLLDEEKR | PRIDE |
PAp00000276 | 17 | 260 | 276 | AEAGEAGQATAEAECHR | Peptide Atlas |