Annotation Detail for TP63


Gene Symbol: | TP63 ( AIS,B(p51A),B(p51B),EEC3,KET,LMS,NBP,OFC8,RHS,SHFM4,TP53CP,TP53L,TP73L,p40,p51,p53CP,p63,p73H,p73L ) |
---|---|
Gene Full Name: | tumor protein p63 |
Band: | 3q28 |
Quick Links | Entrez ID:8626; OMIM: 603273; Uniprot ID:P63_HUMAN; ENSEMBL ID: ENSG00000073282; HGNC ID: 15979 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.137569
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 3 / 70761 | 42 | ![]() |
blastocyst | 0 / 62319 | 0 | |
fetus | 23 / 564012 | 40 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 1 / 55556 | 17 | ![]() |
adult | 76 / 1939121 | 39 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 1 / 114246 | 8 | ![]() |
esophageal tumor | 2 / 17290 | 115 | ![]() |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 0 / 263845 | 0 | |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 61 / 136302 | 447 | ![]() |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 1 / 71755 | 13 | ![]() |
non-neoplasia | 3 / 97250 | 30 | ![]() |
normal | 55 / 3360307 | 16 | ![]() |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 7 / 124949 | 56 | ![]() |
soft tissue/muscle tissue tumor | 1 / 125191 | 7 | ![]() |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 4 / 29757 | 134 | ![]() |
blood | 0 / 123478 | 0 | |
bone | 0 / 71655 | 0 | |
bone marrow | 0 / 48801 | 0 | |
brain | 0 / 1100989 | 0 | |
cervix | 0 / 48171 | 0 | |
connective tissue | 1 / 149255 | 6 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 5 / 215722 | 23 | ![]() |
esophagus | 2 / 20209 | 98 | ![]() |
eye | 3 / 211054 | 14 | ![]() |
heart | 12 / 89626 | 133 | ![]() |
intestine | 1 / 234472 | 4 | ![]() |
kidney | 0 / 211777 | 0 | |
larynx | 2 / 24145 | 82 | ![]() |
liver | 0 / 207743 | 0 | |
lung | 8 / 336974 | 23 | ![]() |
lymph | 1 / 44270 | 22 | ![]() |
lymph node | 0 / 91610 | 0 | |
mammary gland | 0 / 153271 | 0 | |
mouth | 54 / 67052 | 805 | ![]() |
muscle | 4 / 107715 | 37 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 5 / 41328 | 120 | ![]() |
pituitary gland | 0 / 16585 | 0 | |
placenta | 3 / 280825 | 10 | ![]() |
prostate | 8 / 189345 | 42 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 14 / 210574 | 66 | ![]() |
spleen | 0 / 53952 | 0 | |
stomach | 0 / 96619 | 0 | |
testis | 5 / 330442 | 15 | ![]() |
thymus | 6 / 81131 | 73 | ![]() |
thyroid | 1 / 47473 | 21 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 3 / 52413 | 57 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 0 / 232878 | 0 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 211194_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 6 | ![]() |
Adipocyte | 4.8 | ![]() |
AdrenalCortex | 5.45 | ![]() |
Adrenalgland | 4.25 | ![]() |
Amygdala | 5.1 | ![]() |
Appendix | 5.3 | ![]() |
AtrioventricularNode | 4.6 | ![]() |
BDCA4+_DentriticCells | 5.15 | ![]() |
Bonemarrow | 5.05 | ![]() |
BronchialEpithelialCells | 76.95 | ![]() |
CD105+_Endothelial | 4.95 | ![]() |
CD14+_Monocytes | 5.25 | ![]() |
CD19+_BCells(neg._sel.) | 5.2 | ![]() |
CD33+_Myeloid | 6.25 | ![]() |
CD34+ | 6.1 | ![]() |
CD4+_Tcells | 5.35 | ![]() |
CD56+_NKCells | 5.85 | ![]() |
CD71+_EarlyErythroid | 4.65 | ![]() |
CD8+_Tcells | 4.6 | ![]() |
CardiacMyocytes | 6.85 | ![]() |
Caudatenucleus | 4.4 | ![]() |
Cerebellum | 3.95 | ![]() |
CerebellumPeduncles | 5.75 | ![]() |
CiliaryGanglion | 3.6 | ![]() |
CingulateCortex | 5.05 | ![]() |
Colorectaladenocarcinoma | 4.9 | ![]() |
DorsalRootGanglion | 4.1 | ![]() |
FetalThyroid | 4.8 | ![]() |
Fetalbrain | 4.8 | ![]() |
Fetalliver | 4.35 | ![]() |
Fetallung | 4 | ![]() |
GlobusPallidus | 3.8 | ![]() |
Heart | 6.75 | ![]() |
Hypothalamus | 5.3 | ![]() |
Kidney | 4.15 | ![]() |
Leukemia_chronicMyelogenousK-562 | 4.4 | ![]() |
Leukemia_promyelocytic-HL-60 | 4.35 | ![]() |
Leukemialymphoblastic(MOLT-4) | 3.85 | ![]() |
Liver | 6.75 | ![]() |
Lung | 5.3 | ![]() |
Lymphnode | 4.15 | ![]() |
Lymphoma_burkitts(Daudi) | 6.4 | ![]() |
Lymphoma_burkitts(Raji) | 7.15 | ![]() |
MedullaOblongata | 4.45 | ![]() |
OccipitalLobe | 4.4 | ![]() |
OlfactoryBulb | 3.85 | ![]() |
Ovary | 3.4 | ![]() |
Pancreas | 4.05 | ![]() |
PancreaticIslet | 5.2 | ![]() |
ParietalLobe | 5.4 | ![]() |
Pituitary | 5.75 | ![]() |
Placenta | 5.05 | ![]() |
Pons | 4.75 | ![]() |
PrefrontalCortex | 6.05 | ![]() |
Prostate | 5.65 | ![]() |
Salivarygland | 4 | ![]() |
SkeletalMuscle | 6.3 | ![]() |
Skin | 4.6 | ![]() |
SmoothMuscle | 5.5 | ![]() |
Spinalcord | 5.2 | ![]() |
SubthalamicNucleus | 4.55 | ![]() |
SuperiorCervicalGanglion | 8.35 | ![]() |
TemporalLobe | 4.5 | ![]() |
Testis | 4.2 | ![]() |
TestisGermCell | 3.95 | ![]() |
TestisIntersitial | 4.1 | ![]() |
TestisLeydigCell | 4.9 | ![]() |
TestisSeminiferousTubule | 4.2 | ![]() |
Thalamus | 5.05 | ![]() |
Thymus | 3.85 | ![]() |
Thyroid | 6 | ![]() |
Tongue | 5.05 | ![]() |
Tonsil | 4.85 | ![]() |
Trachea | 4.1 | ![]() |
TrigeminalGanglion | 5.45 | ![]() |
Uterus | 3.9 | ![]() |
UterusCorpus | 4.6 | ![]() |
WholeBlood | 5.35 | ![]() |
Wholebrain | 4.05 | ![]() |
colon | 4.95 | ![]() |
pineal_day | 6.02 | ![]() |
pineal_night | 5.98 | ![]() |
retina | 5.925 | ![]() |
small_intestine | 4.7 | ![]() |
- Probe name: A_24_P273756
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 3.4 ± 1.16 | ![]() ![]() ![]() |
Basal Forebrain | 2.8 ± 0.41 | ![]() ![]() ![]() |
Basal Part of Pons | 2.54 ± 0.71 | ![]() ![]() ![]() |
Cerebellar Cortex | 2.54 ± 0.98 | ![]() ![]() ![]() |
Cerebellar Nuclei | 2.92 ± 0.72 | ![]() ![]() ![]() |
Claustrum | 3.8 ± 1.01 | ![]() ![]() ![]() |
Epithalamus | 3.21 ± 1.02 | ![]() ![]() ![]() |
Frontal Lobe | 2.75 ± 0.97 | ![]() ![]() ![]() |
Globus Pallidus | 3.56 ± 0.9 | ![]() ![]() ![]() |
Hypothalamus | 2.72 ± 0.79 | ![]() ![]() ![]() |
Insula | 2.24 ± 0.35 | ![]() ![]() ![]() |
Limbic Lobe | 2.8 ± 0.89 | ![]() ![]() ![]() |
Mesencephalon | 2.94 ± 0.87 | ![]() ![]() ![]() |
Myelencephalon | 2.85 ± 0.85 | ![]() ![]() ![]() |
Occipital Lobe | 2.64 ± 0.79 | ![]() ![]() ![]() |
Parietal Lobe | 2.85 ± 0.96 | ![]() ![]() ![]() |
Pontine Tegmentum | 2.69 ± 0.78 | ![]() ![]() ![]() |
Striatum | 2.9 ± 0.75 | ![]() ![]() ![]() |
Subthalamus | 2.82 ± 0.92 | ![]() ![]() ![]() |
Temporal Lobe | 2.7 ± 0.93 | ![]() ![]() ![]() |
Thalamus | 2.7 ± 0.72 | ![]() ![]() ![]() |
White Matter | 2.9 ± 0.23 | ![]() ![]() ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00131832 | 33 | 556 | 588 | LGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLK | Peptide Atlas |