Annotation Detail for TP63
Basic Information Top
| Gene Symbol: | TP63 ( AIS,B(p51A),B(p51B),EEC3,KET,LMS,NBP,OFC8,RHS,SHFM4,TP53CP,TP53L,TP73L,p40,p51,p53CP,p63,p73H,p73L ) |
|---|---|
| Gene Full Name: | tumor protein p63 |
| Band: | 3q28 |
| Quick Links | Entrez ID:8626; OMIM: 603273; Uniprot ID:P63_HUMAN; ENSEMBL ID: ENSG00000073282; HGNC ID: 15979 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.137569
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 3 / 70761 | 42 | |
| blastocyst | 0 / 62319 | 0 | |
| fetus | 23 / 564012 | 40 | |
| neonate | 0 / 31097 | 0 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 76 / 1939121 | 39 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 0 / 94178 | 0 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 0 / 82823 | 0 | |
| colorectal tumor | 1 / 114246 | 8 | |
| esophageal tumor | 2 / 17290 | 115 | |
| gastrointestinal tumor | 0 / 119369 | 0 | |
| germ cell tumor | 0 / 263845 | 0 | |
| glioma | 0 / 106883 | 0 | |
| head and neck tumor | 61 / 136302 | 447 | |
| kidney tumor | 0 / 68959 | 0 | |
| leukemia | 0 / 95842 | 0 | |
| liver tumor | 0 / 96359 | 0 | |
| lung tumor | 0 / 103127 | 0 | |
| lymphoma | 1 / 71755 | 13 | |
| non-neoplasia | 3 / 97250 | 30 | |
| normal | 55 / 3360307 | 16 | |
| ovarian tumor | 0 / 76682 | 0 | |
| pancreatic tumor | 0 / 104616 | 0 | |
| primitive neuroectodermal tumor of the CNS | 0 / 125680 | 0 | |
| prostate cancer | 0 / 102680 | 0 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 7 / 124949 | 56 | |
| soft tissue/muscle tissue tumor | 1 / 125191 | 7 | |
| uterine tumor | 0 / 90257 | 0 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 4 / 29757 | 134 | |
| blood | 0 / 123478 | 0 | |
| bone | 0 / 71655 | 0 | |
| bone marrow | 0 / 48801 | 0 | |
| brain | 0 / 1100989 | 0 | |
| cervix | 0 / 48171 | 0 | |
| connective tissue | 1 / 149255 | 6 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 5 / 215722 | 23 | |
| esophagus | 2 / 20209 | 98 | |
| eye | 3 / 211054 | 14 | |
| heart | 12 / 89626 | 133 | |
| intestine | 1 / 234472 | 4 | |
| kidney | 0 / 211777 | 0 | |
| larynx | 2 / 24145 | 82 | |
| liver | 0 / 207743 | 0 | |
| lung | 8 / 336974 | 23 | |
| lymph | 1 / 44270 | 22 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 0 / 153271 | 0 | |
| mouth | 54 / 67052 | 805 | |
| muscle | 4 / 107715 | 37 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 0 / 102051 | 0 | |
| pancreas | 0 / 214812 | 0 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 5 / 41328 | 120 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 3 / 280825 | 10 | |
| prostate | 8 / 189345 | 42 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 14 / 210574 | 66 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 0 / 96619 | 0 | |
| testis | 5 / 330442 | 15 | |
| thymus | 6 / 81131 | 73 | |
| thyroid | 1 / 47473 | 21 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 3 / 52413 | 57 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 0 / 232878 | 0 | |
| vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 211194_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 6 | |
| Adipocyte | 4.8 | |
| AdrenalCortex | 5.45 | |
| Adrenalgland | 4.25 | |
| Amygdala | 5.1 | |
| Appendix | 5.3 | |
| AtrioventricularNode | 4.6 | |
| BDCA4+_DentriticCells | 5.15 | |
| Bonemarrow | 5.05 | |
| BronchialEpithelialCells | 76.95 | |
| CD105+_Endothelial | 4.95 | |
| CD14+_Monocytes | 5.25 | |
| CD19+_BCells(neg._sel.) | 5.2 | |
| CD33+_Myeloid | 6.25 | |
| CD34+ | 6.1 | |
| CD4+_Tcells | 5.35 | |
| CD56+_NKCells | 5.85 | |
| CD71+_EarlyErythroid | 4.65 | |
| CD8+_Tcells | 4.6 | |
| CardiacMyocytes | 6.85 | |
| Caudatenucleus | 4.4 | |
| Cerebellum | 3.95 | |
| CerebellumPeduncles | 5.75 | |
| CiliaryGanglion | 3.6 | |
| CingulateCortex | 5.05 | |
| Colorectaladenocarcinoma | 4.9 | |
| DorsalRootGanglion | 4.1 | |
| FetalThyroid | 4.8 | |
| Fetalbrain | 4.8 | |
| Fetalliver | 4.35 | |
| Fetallung | 4 | |
| GlobusPallidus | 3.8 | |
| Heart | 6.75 | |
| Hypothalamus | 5.3 | |
| Kidney | 4.15 | |
| Leukemia_chronicMyelogenousK-562 | 4.4 | |
| Leukemia_promyelocytic-HL-60 | 4.35 | |
| Leukemialymphoblastic(MOLT-4) | 3.85 | |
| Liver | 6.75 | |
| Lung | 5.3 | |
| Lymphnode | 4.15 | |
| Lymphoma_burkitts(Daudi) | 6.4 | |
| Lymphoma_burkitts(Raji) | 7.15 | |
| MedullaOblongata | 4.45 | |
| OccipitalLobe | 4.4 | |
| OlfactoryBulb | 3.85 | |
| Ovary | 3.4 | |
| Pancreas | 4.05 | |
| PancreaticIslet | 5.2 | |
| ParietalLobe | 5.4 | |
| Pituitary | 5.75 | |
| Placenta | 5.05 | |
| Pons | 4.75 | |
| PrefrontalCortex | 6.05 | |
| Prostate | 5.65 | |
| Salivarygland | 4 | |
| SkeletalMuscle | 6.3 | |
| Skin | 4.6 | |
| SmoothMuscle | 5.5 | |
| Spinalcord | 5.2 | |
| SubthalamicNucleus | 4.55 | |
| SuperiorCervicalGanglion | 8.35 | |
| TemporalLobe | 4.5 | |
| Testis | 4.2 | |
| TestisGermCell | 3.95 | |
| TestisIntersitial | 4.1 | |
| TestisLeydigCell | 4.9 | |
| TestisSeminiferousTubule | 4.2 | |
| Thalamus | 5.05 | |
| Thymus | 3.85 | |
| Thyroid | 6 | |
| Tongue | 5.05 | |
| Tonsil | 4.85 | |
| Trachea | 4.1 | |
| TrigeminalGanglion | 5.45 | |
| Uterus | 3.9 | |
| UterusCorpus | 4.6 | |
| WholeBlood | 5.35 | |
| Wholebrain | 4.05 | |
| colon | 4.95 | |
| pineal_day | 6.02 | |
| pineal_night | 5.98 | |
| retina | 5.925 | |
| small_intestine | 4.7 |
- Probe name: A_24_P273756
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 3.4 ± 1.16 | |
| Basal Forebrain | 2.8 ± 0.41 | |
| Basal Part of Pons | 2.54 ± 0.71 | |
| Cerebellar Cortex | 2.54 ± 0.98 | |
| Cerebellar Nuclei | 2.92 ± 0.72 | |
| Claustrum | 3.8 ± 1.01 | |
| Epithalamus | 3.21 ± 1.02 | |
| Frontal Lobe | 2.75 ± 0.97 | |
| Globus Pallidus | 3.56 ± 0.9 | |
| Hypothalamus | 2.72 ± 0.79 | |
| Insula | 2.24 ± 0.35 | |
| Limbic Lobe | 2.8 ± 0.89 | |
| Mesencephalon | 2.94 ± 0.87 | |
| Myelencephalon | 2.85 ± 0.85 | |
| Occipital Lobe | 2.64 ± 0.79 | |
| Parietal Lobe | 2.85 ± 0.96 | |
| Pontine Tegmentum | 2.69 ± 0.78 | |
| Striatum | 2.9 ± 0.75 | |
| Subthalamus | 2.82 ± 0.92 | |
| Temporal Lobe | 2.7 ± 0.93 | |
| Thalamus | 2.7 ± 0.72 | |
| White Matter | 2.9 ± 0.23 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00131832 | 33 | 556 | 588 | LGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLK | Peptide Atlas |




Mouse Brain ISH