Annotation Detail for AKR1C3
Basic Information Top
| Gene Symbol: | AKR1C3 ( DD3,DDX,HA1753,HAKRB,HAKRe,HSD17B5,KIAA0119,PGFS,hluPGFS ) |
|---|---|
| Gene Full Name: | aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) |
| Band: | 10p15.1 |
| Quick Links | Entrez ID:8644; OMIM: 603966; Uniprot ID:AK1C3_HUMAN; ENSEMBL ID: ENSG00000196139; HGNC ID: 386 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.78183
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 0 / 70761 | 0 | |
| blastocyst | 0 / 62319 | 0 | |
| fetus | 40 / 564012 | 70 | |
| neonate | 0 / 31097 | 0 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 0 / 55556 | 0 | |
| adult | 237 / 1939121 | 122 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 20 / 17475 | 1144 | |
| breast (mammary gland) tumor | 5 / 94178 | 53 | |
| cervical tumor | 6 / 34366 | 174 | |
| chondrosarcoma | 13 / 82823 | 156 | |
| colorectal tumor | 16 / 114246 | 140 | |
| esophageal tumor | 5 / 17290 | 289 | |
| gastrointestinal tumor | 21 / 119369 | 175 | |
| germ cell tumor | 7 / 263845 | 26 | |
| glioma | 3 / 106883 | 28 | |
| head and neck tumor | 17 / 136302 | 124 | |
| kidney tumor | 2 / 68959 | 29 | |
| leukemia | 0 / 95842 | 0 | |
| liver tumor | 93 / 96359 | 965 | |
| lung tumor | 81 / 103127 | 785 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 0 / 97250 | 0 | |
| normal | 222 / 3360307 | 66 | |
| ovarian tumor | 1 / 76682 | 13 | |
| pancreatic tumor | 6 / 104616 | 57 | |
| primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | |
| prostate cancer | 6 / 102680 | 58 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 8 / 125191 | 63 | |
| uterine tumor | 5 / 90257 | 55 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 4 / 13106 | 305 | |
| adrenal gland | 1 / 33197 | 30 | |
| ascites | 9 / 40015 | 224 | |
| bladder | 20 / 29757 | 672 | |
| blood | 3 / 123478 | 24 | |
| bone | 12 / 71655 | 167 | |
| bone marrow | 10 / 48801 | 204 | |
| brain | 19 / 1100989 | 17 | |
| cervix | 8 / 48171 | 166 | |
| connective tissue | 8 / 149255 | 53 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 2 / 215722 | 9 | |
| esophagus | 5 / 20209 | 247 | |
| eye | 9 / 211054 | 42 | |
| heart | 3 / 89626 | 33 | |
| intestine | 36 / 234472 | 153 | |
| kidney | 27 / 211777 | 127 | |
| larynx | 2 / 24145 | 82 | |
| liver | 137 / 207743 | 659 | |
| lung | 111 / 336974 | 329 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 4 / 91610 | 43 | |
| mammary gland | 12 / 153271 | 78 | |
| mouth | 12 / 67052 | 178 | |
| muscle | 10 / 107715 | 92 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 1 / 102051 | 9 | |
| pancreas | 23 / 214812 | 107 | |
| parathyroid | 30 / 20539 | 1460 | |
| pharynx | 6 / 41328 | 145 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 5 / 280825 | 17 | |
| prostate | 6 / 189345 | 31 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 1 / 210574 | 4 | |
| spleen | 1 / 53952 | 18 | |
| stomach | 18 / 96619 | 186 | |
| testis | 6 / 330442 | 18 | |
| thymus | 1 / 81131 | 12 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 1 / 52413 | 19 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 8 / 232878 | 34 | |
| vascular | 7 / 51780 | 135 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 209160_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 18.85 | |
| Adipocyte | 1619.45 | |
| AdrenalCortex | 5.85 | |
| Adrenalgland | 15.6 | |
| Amygdala | 5.7 | |
| Appendix | 5.85 | |
| AtrioventricularNode | 4.8 | |
| BDCA4+_DentriticCells | 19.4 | |
| Bonemarrow | 8.35 | |
| BronchialEpithelialCells | 859.1 | |
| CD105+_Endothelial | 2011.35 | |
| CD14+_Monocytes | 5.9 | |
| CD19+_BCells(neg._sel.) | 5.65 | |
| CD33+_Myeloid | 6.85 | |
| CD34+ | 401.05 | |
| CD4+_Tcells | 6.05 | |
| CD56+_NKCells | 931.1 | |
| CD71+_EarlyErythroid | 77.05 | |
| CD8+_Tcells | 5.1 | |
| CardiacMyocytes | 47.4 | |
| Caudatenucleus | 5.05 | |
| Cerebellum | 4.5 | |
| CerebellumPeduncles | 6.3 | |
| CiliaryGanglion | 4.45 | |
| CingulateCortex | 5.7 | |
| Colorectaladenocarcinoma | 5.55 | |
| DorsalRootGanglion | 4.5 | |
| FetalThyroid | 8.5 | |
| Fetalbrain | 5.35 | |
| Fetalliver | 34.05 | |
| Fetallung | 6.05 | |
| GlobusPallidus | 4.15 | |
| Heart | 11.05 | |
| Hypothalamus | 6.05 | |
| Kidney | 267.35 | |
| Leukemia_chronicMyelogenousK-562 | 5 | |
| Leukemia_promyelocytic-HL-60 | 4.9 | |
| Leukemialymphoblastic(MOLT-4) | 4.3 | |
| Liver | 193.15 | |
| Lung | 213.8 | |
| Lymphnode | 4.7 | |
| Lymphoma_burkitts(Daudi) | 7.15 | |
| Lymphoma_burkitts(Raji) | 7.95 | |
| MedullaOblongata | 4.95 | |
| OccipitalLobe | 4.95 | |
| OlfactoryBulb | 4.35 | |
| Ovary | 3.75 | |
| Pancreas | 122.45 | |
| PancreaticIslet | 84.45 | |
| ParietalLobe | 5.95 | |
| Pituitary | 6.4 | |
| Placenta | 5.45 | |
| Pons | 5.3 | |
| PrefrontalCortex | 7 | |
| Prostate | 6.35 | |
| Salivarygland | 4.6 | |
| SkeletalMuscle | 7.15 | |
| Skin | 4.7 | |
| SmoothMuscle | 434.5 | |
| Spinalcord | 6 | |
| SubthalamicNucleus | 5.1 | |
| SuperiorCervicalGanglion | 6.95 | |
| TemporalLobe | 5.2 | |
| Testis | 4.75 | |
| TestisGermCell | 4.45 | |
| TestisIntersitial | 4.65 | |
| TestisLeydigCell | 5.65 | |
| TestisSeminiferousTubule | 4.7 | |
| Thalamus | 5.75 | |
| Thymus | 82.8 | |
| Thyroid | 6.85 | |
| Tongue | 6.95 | |
| Tonsil | 5.45 | |
| Trachea | 73.5 | |
| TrigeminalGanglion | 5.6 | |
| Uterus | 13.55 | |
| UterusCorpus | 5.05 | |
| WholeBlood | 7.15 | |
| Wholebrain | 4.7 | |
| colon | 417.2 | |
| pineal_day | 8.44 | |
| pineal_night | 6.9 | |
| retina | 18.85 | |
| small_intestine | 1319.55 |
- Probe name: CUST_15152_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 6.78 ± 0.26 | |
| Basal Forebrain | 6.94 ± 0.31 | |
| Basal Part of Pons | 7.33 ± 0.33 | |
| Cerebellar Cortex | 6.53 ± 0.24 | |
| Cerebellar Nuclei | 7.05 ± 0.34 | |
| Claustrum | 7.27 ± 0.58 | |
| Epithalamus | 7.23 ± 0.52 | |
| Frontal Lobe | 7.19 ± 0.43 | |
| Globus Pallidus | 7.16 ± 0.46 | |
| Hypothalamus | 7.57 ± 0.46 | |
| Insula | 7.06 ± 0.3 | |
| Limbic Lobe | 6.64 ± 0.49 | |
| Mesencephalon | 6.91 ± 0.49 | |
| Myelencephalon | 7.07 ± 0.57 | |
| Occipital Lobe | 6.58 ± 0.46 | |
| Parietal Lobe | 6.98 ± 0.49 | |
| Pontine Tegmentum | 7.11 ± 0.46 | |
| Striatum | 7.92 ± 0.42 | |
| Subthalamus | 7.06 ± 0.39 | |
| Temporal Lobe | 7.01 ± 0.42 | |
| Thalamus | 7.47 ± 0.43 | |
| White Matter | 6.07 ± 0.33 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Akr1c18 | CB | Cerebellum | 1.67 | |
| 2.5 | ||||
| Akr1c18 | CTX | Cerebral cortex | 4.09 | |
| 4.33 | ||||
| Akr1c18 | HIP | Hippocampal region | 2.04 | |
| 3.64 | ||||
| Akr1c18 | HPF | Hippocampal formation | 1.85 | |
| 2.78 | ||||
| Akr1c18 | HY | Hypothalamus | 0.28 | |
| 0.29 | ||||
| Akr1c18 | LSX | Lateral septal complex | 0.7 | |
| 0.97 | ||||
| Akr1c18 | MB | Midbrain | 1.02 | |
| 1.35 | ||||
| Akr1c18 | MY | Medulla | 3.72 | |
| 4.33 | ||||
| Akr1c18 | OLF | Olfactory bulb | 4.16 | |
| 5.61 | ||||
| Akr1c18 | P | Pons | 1.87 | |
| 1.9 | ||||
| Akr1c18 | PAL | Pallidum | 0.58 | |
| 0.48 | ||||
| Akr1c18 | RHP | Retrohippocampal region | 1.53 | |
| 1.66 | ||||
| Akr1c18 | sAMY | Striatum-like amygdalar nuclei | 0.41 | |
| 0.3 | ||||
| Akr1c18 | STR | Striatum | 0.59 | |
| 0.91 | ||||
| Akr1c18 | STRd | Striatum dorsal region | 0.4 | |
| 0.8 | ||||
| Akr1c18 | STRv | Striatum ventral region | 1.22 | |
| 1.42 | ||||
| Akr1c18 | TH | Thalamus | 0.41 | |
| 0.43 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| AK1C3_HUMAN_1 | 31 | 1 | 31 | MDSKQQCVKLNDGHFMPVLGFGTYAPPEVPR | PRIDE |
| AK1C3_HUMAN_10 | 22 | 10 | 31 | LNDGHFMPVLGFGTYAPPEVPR | PRIDE |
| AK1C3_HUMAN_287 | 15 | 287 | 301 | QLTAEDMKAIDGLDR | PRIDE |
| AK1C3_HUMAN_32 | 16 | 32 | 47 | SKALEVTKLAIEAGFR | PRIDE |
| PAp00006245 | 17 | 230 | 246 | PNSPVLLEDPVLCALAK | Peptide Atlas |



