Annotation Detail for AKR1C3


Gene Symbol: | AKR1C3 ( DD3,DDX,HA1753,HAKRB,HAKRe,HSD17B5,KIAA0119,PGFS,hluPGFS ) |
---|---|
Gene Full Name: | aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) |
Band: | 10p15.1 |
Quick Links | Entrez ID:8644; OMIM: 603966; Uniprot ID:AK1C3_HUMAN; ENSEMBL ID: ENSG00000196139; HGNC ID: 386 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.78183
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 40 / 564012 | 70 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 0 / 23620 | 0 | |
juvenile | 0 / 55556 | 0 | |
adult | 237 / 1939121 | 122 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 20 / 17475 | 1144 | ![]() |
breast (mammary gland) tumor | 5 / 94178 | 53 | ![]() |
cervical tumor | 6 / 34366 | 174 | ![]() |
chondrosarcoma | 13 / 82823 | 156 | ![]() |
colorectal tumor | 16 / 114246 | 140 | ![]() |
esophageal tumor | 5 / 17290 | 289 | ![]() |
gastrointestinal tumor | 21 / 119369 | 175 | ![]() |
germ cell tumor | 7 / 263845 | 26 | ![]() |
glioma | 3 / 106883 | 28 | ![]() |
head and neck tumor | 17 / 136302 | 124 | ![]() |
kidney tumor | 2 / 68959 | 29 | ![]() |
leukemia | 0 / 95842 | 0 | |
liver tumor | 93 / 96359 | 965 | ![]() |
lung tumor | 81 / 103127 | 785 | ![]() |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 0 / 97250 | 0 | |
normal | 222 / 3360307 | 66 | ![]() |
ovarian tumor | 1 / 76682 | 13 | ![]() |
pancreatic tumor | 6 / 104616 | 57 | ![]() |
primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | ![]() |
prostate cancer | 6 / 102680 | 58 | ![]() |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 8 / 125191 | 63 | ![]() |
uterine tumor | 5 / 90257 | 55 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 4 / 13106 | 305 | ![]() |
adrenal gland | 1 / 33197 | 30 | ![]() |
ascites | 9 / 40015 | 224 | ![]() |
bladder | 20 / 29757 | 672 | ![]() |
blood | 3 / 123478 | 24 | ![]() |
bone | 12 / 71655 | 167 | ![]() |
bone marrow | 10 / 48801 | 204 | ![]() |
brain | 19 / 1100989 | 17 | ![]() |
cervix | 8 / 48171 | 166 | ![]() |
connective tissue | 8 / 149255 | 53 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 2 / 215722 | 9 | ![]() |
esophagus | 5 / 20209 | 247 | ![]() |
eye | 9 / 211054 | 42 | ![]() |
heart | 3 / 89626 | 33 | ![]() |
intestine | 36 / 234472 | 153 | ![]() |
kidney | 27 / 211777 | 127 | ![]() |
larynx | 2 / 24145 | 82 | ![]() |
liver | 137 / 207743 | 659 | ![]() |
lung | 111 / 336974 | 329 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 4 / 91610 | 43 | ![]() |
mammary gland | 12 / 153271 | 78 | ![]() |
mouth | 12 / 67052 | 178 | ![]() |
muscle | 10 / 107715 | 92 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 1 / 102051 | 9 | ![]() |
pancreas | 23 / 214812 | 107 | ![]() |
parathyroid | 30 / 20539 | 1460 | ![]() |
pharynx | 6 / 41328 | 145 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 5 / 280825 | 17 | ![]() |
prostate | 6 / 189345 | 31 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 1 / 210574 | 4 | ![]() |
spleen | 1 / 53952 | 18 | ![]() |
stomach | 18 / 96619 | 186 | ![]() |
testis | 6 / 330442 | 18 | ![]() |
thymus | 1 / 81131 | 12 | ![]() |
thyroid | 2 / 47473 | 42 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 1 / 52413 | 19 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 8 / 232878 | 34 | ![]() |
vascular | 7 / 51780 | 135 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 209160_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 18.85 | ![]() |
Adipocyte | 1619.45 | ![]() |
AdrenalCortex | 5.85 | ![]() |
Adrenalgland | 15.6 | ![]() |
Amygdala | 5.7 | ![]() |
Appendix | 5.85 | ![]() |
AtrioventricularNode | 4.8 | ![]() |
BDCA4+_DentriticCells | 19.4 | ![]() |
Bonemarrow | 8.35 | ![]() |
BronchialEpithelialCells | 859.1 | ![]() |
CD105+_Endothelial | 2011.35 | ![]() |
CD14+_Monocytes | 5.9 | ![]() |
CD19+_BCells(neg._sel.) | 5.65 | ![]() |
CD33+_Myeloid | 6.85 | ![]() |
CD34+ | 401.05 | ![]() |
CD4+_Tcells | 6.05 | ![]() |
CD56+_NKCells | 931.1 | ![]() |
CD71+_EarlyErythroid | 77.05 | ![]() |
CD8+_Tcells | 5.1 | ![]() |
CardiacMyocytes | 47.4 | ![]() |
Caudatenucleus | 5.05 | ![]() |
Cerebellum | 4.5 | ![]() |
CerebellumPeduncles | 6.3 | ![]() |
CiliaryGanglion | 4.45 | ![]() |
CingulateCortex | 5.7 | ![]() |
Colorectaladenocarcinoma | 5.55 | ![]() |
DorsalRootGanglion | 4.5 | ![]() |
FetalThyroid | 8.5 | ![]() |
Fetalbrain | 5.35 | ![]() |
Fetalliver | 34.05 | ![]() |
Fetallung | 6.05 | ![]() |
GlobusPallidus | 4.15 | ![]() |
Heart | 11.05 | ![]() |
Hypothalamus | 6.05 | ![]() |
Kidney | 267.35 | ![]() |
Leukemia_chronicMyelogenousK-562 | 5 | ![]() |
Leukemia_promyelocytic-HL-60 | 4.9 | ![]() |
Leukemialymphoblastic(MOLT-4) | 4.3 | ![]() |
Liver | 193.15 | ![]() |
Lung | 213.8 | ![]() |
Lymphnode | 4.7 | ![]() |
Lymphoma_burkitts(Daudi) | 7.15 | ![]() |
Lymphoma_burkitts(Raji) | 7.95 | ![]() |
MedullaOblongata | 4.95 | ![]() |
OccipitalLobe | 4.95 | ![]() |
OlfactoryBulb | 4.35 | ![]() |
Ovary | 3.75 | ![]() |
Pancreas | 122.45 | ![]() |
PancreaticIslet | 84.45 | ![]() |
ParietalLobe | 5.95 | ![]() |
Pituitary | 6.4 | ![]() |
Placenta | 5.45 | ![]() |
Pons | 5.3 | ![]() |
PrefrontalCortex | 7 | ![]() |
Prostate | 6.35 | ![]() |
Salivarygland | 4.6 | ![]() |
SkeletalMuscle | 7.15 | ![]() |
Skin | 4.7 | ![]() |
SmoothMuscle | 434.5 | ![]() |
Spinalcord | 6 | ![]() |
SubthalamicNucleus | 5.1 | ![]() |
SuperiorCervicalGanglion | 6.95 | ![]() |
TemporalLobe | 5.2 | ![]() |
Testis | 4.75 | ![]() |
TestisGermCell | 4.45 | ![]() |
TestisIntersitial | 4.65 | ![]() |
TestisLeydigCell | 5.65 | ![]() |
TestisSeminiferousTubule | 4.7 | ![]() |
Thalamus | 5.75 | ![]() |
Thymus | 82.8 | ![]() |
Thyroid | 6.85 | ![]() |
Tongue | 6.95 | ![]() |
Tonsil | 5.45 | ![]() |
Trachea | 73.5 | ![]() |
TrigeminalGanglion | 5.6 | ![]() |
Uterus | 13.55 | ![]() |
UterusCorpus | 5.05 | ![]() |
WholeBlood | 7.15 | ![]() |
Wholebrain | 4.7 | ![]() |
colon | 417.2 | ![]() |
pineal_day | 8.44 | ![]() |
pineal_night | 6.9 | ![]() |
retina | 18.85 | ![]() |
small_intestine | 1319.55 | ![]() |
- Probe name: CUST_15152_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 6.78 ± 0.26 | ![]() ![]() ![]() |
Basal Forebrain | 6.94 ± 0.31 | ![]() ![]() ![]() |
Basal Part of Pons | 7.33 ± 0.33 | ![]() ![]() ![]() |
Cerebellar Cortex | 6.53 ± 0.24 | ![]() ![]() ![]() |
Cerebellar Nuclei | 7.05 ± 0.34 | ![]() ![]() ![]() |
Claustrum | 7.27 ± 0.58 | ![]() ![]() ![]() |
Epithalamus | 7.23 ± 0.52 | ![]() ![]() ![]() |
Frontal Lobe | 7.19 ± 0.43 | ![]() ![]() ![]() |
Globus Pallidus | 7.16 ± 0.46 | ![]() ![]() ![]() |
Hypothalamus | 7.57 ± 0.46 | ![]() ![]() ![]() |
Insula | 7.06 ± 0.3 | ![]() ![]() ![]() |
Limbic Lobe | 6.64 ± 0.49 | ![]() ![]() ![]() |
Mesencephalon | 6.91 ± 0.49 | ![]() ![]() ![]() |
Myelencephalon | 7.07 ± 0.57 | ![]() ![]() ![]() |
Occipital Lobe | 6.58 ± 0.46 | ![]() ![]() ![]() |
Parietal Lobe | 6.98 ± 0.49 | ![]() ![]() ![]() |
Pontine Tegmentum | 7.11 ± 0.46 | ![]() ![]() ![]() |
Striatum | 7.92 ± 0.42 | ![]() ![]() ![]() |
Subthalamus | 7.06 ± 0.39 | ![]() ![]() ![]() |
Temporal Lobe | 7.01 ± 0.42 | ![]() ![]() ![]() |
Thalamus | 7.47 ± 0.43 | ![]() ![]() ![]() |
White Matter | 6.07 ± 0.33 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Akr1c18 | CB | Cerebellum | 1.67 | ![]() |
2.5 | ![]() | |||
Akr1c18 | CTX | Cerebral cortex | 4.09 | ![]() |
4.33 | ![]() | |||
Akr1c18 | HIP | Hippocampal region | 2.04 | ![]() |
3.64 | ![]() | |||
Akr1c18 | HPF | Hippocampal formation | 1.85 | ![]() |
2.78 | ![]() | |||
Akr1c18 | HY | Hypothalamus | 0.28 | ![]() |
0.29 | ![]() | |||
Akr1c18 | LSX | Lateral septal complex | 0.7 | ![]() |
0.97 | ![]() | |||
Akr1c18 | MB | Midbrain | 1.02 | ![]() |
1.35 | ![]() | |||
Akr1c18 | MY | Medulla | 3.72 | ![]() |
4.33 | ![]() | |||
Akr1c18 | OLF | Olfactory bulb | 4.16 | ![]() |
5.61 | ![]() | |||
Akr1c18 | P | Pons | 1.87 | ![]() |
1.9 | ![]() | |||
Akr1c18 | PAL | Pallidum | 0.58 | ![]() |
0.48 | ![]() | |||
Akr1c18 | RHP | Retrohippocampal region | 1.53 | ![]() |
1.66 | ![]() | |||
Akr1c18 | sAMY | Striatum-like amygdalar nuclei | 0.41 | ![]() |
0.3 | ![]() | |||
Akr1c18 | STR | Striatum | 0.59 | ![]() |
0.91 | ![]() | |||
Akr1c18 | STRd | Striatum dorsal region | 0.4 | ![]() |
0.8 | ![]() | |||
Akr1c18 | STRv | Striatum ventral region | 1.22 | ![]() |
1.42 | ![]() | |||
Akr1c18 | TH | Thalamus | 0.41 | ![]() |
0.43 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
AK1C3_HUMAN_1 | 31 | 1 | 31 | MDSKQQCVKLNDGHFMPVLGFGTYAPPEVPR | PRIDE |
AK1C3_HUMAN_10 | 22 | 10 | 31 | LNDGHFMPVLGFGTYAPPEVPR | PRIDE |
AK1C3_HUMAN_287 | 15 | 287 | 301 | QLTAEDMKAIDGLDR | PRIDE |
AK1C3_HUMAN_32 | 16 | 32 | 47 | SKALEVTKLAIEAGFR | PRIDE |
PAp00006245 | 17 | 230 | 246 | PNSPVLLEDPVLCALAK | Peptide Atlas |