Annotation Detail for BUB3


Gene Symbol: | BUB3 ( BUB3L,hBUB3 ) |
---|---|
Gene Full Name: | budding uninhibited by benzimidazoles 3 homolog (yeast) |
Band: | 10q26.13 |
Quick Links | Entrez ID:9184; OMIM: 603719; Uniprot ID:BUB3_HUMAN; ENSEMBL ID: ENSG00000154473; HGNC ID: 1151 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.418533
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 7 / 70761 | 98 | ![]() |
blastocyst | 21 / 62319 | 336 | ![]() |
fetus | 65 / 564012 | 115 | ![]() |
neonate | 5 / 31097 | 160 | ![]() |
infant | 6 / 23620 | 254 | ![]() |
juvenile | 3 / 55556 | 53 | ![]() |
adult | 196 / 1939121 | 101 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 5 / 12794 | 390 | ![]() |
bladder carcinoma | 5 / 17475 | 286 | ![]() |
breast (mammary gland) tumor | 16 / 94178 | 169 | ![]() |
cervical tumor | 2 / 34366 | 58 | ![]() |
chondrosarcoma | 8 / 82823 | 96 | ![]() |
colorectal tumor | 21 / 114246 | 183 | ![]() |
esophageal tumor | 1 / 17290 | 57 | ![]() |
gastrointestinal tumor | 15 / 119369 | 125 | ![]() |
germ cell tumor | 36 / 263845 | 136 | ![]() |
glioma | 9 / 106883 | 84 | ![]() |
head and neck tumor | 26 / 136302 | 190 | ![]() |
kidney tumor | 8 / 68959 | 116 | ![]() |
leukemia | 13 / 95842 | 135 | ![]() |
liver tumor | 20 / 96359 | 207 | ![]() |
lung tumor | 17 / 103127 | 164 | ![]() |
lymphoma | 11 / 71755 | 153 | ![]() |
non-neoplasia | 8 / 97250 | 82 | ![]() |
normal | 389 / 3360307 | 115 | ![]() |
ovarian tumor | 12 / 76682 | 156 | ![]() |
pancreatic tumor | 2 / 104616 | 19 | ![]() |
primitive neuroectodermal tumor of the CNS | 20 / 125680 | 159 | ![]() |
prostate cancer | 6 / 102680 | 58 | ![]() |
retinoblastoma | 6 / 46356 | 129 | ![]() |
skin tumor | 17 / 124949 | 136 | ![]() |
soft tissue/muscle tissue tumor | 14 / 125191 | 111 | ![]() |
uterine tumor | 6 / 90257 | 66 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 8 / 33197 | 240 | ![]() |
ascites | 5 / 40015 | 124 | ![]() |
bladder | 9 / 29757 | 302 | ![]() |
blood | 15 / 123478 | 121 | ![]() |
bone | 8 / 71655 | 111 | ![]() |
bone marrow | 15 / 48801 | 307 | ![]() |
brain | 169 / 1100989 | 153 | ![]() |
cervix | 2 / 48171 | 41 | ![]() |
connective tissue | 17 / 149255 | 113 | ![]() |
ear | 1 / 16212 | 61 | ![]() |
embryonic tissue | 43 / 215722 | 199 | ![]() |
esophagus | 1 / 20209 | 49 | ![]() |
eye | 20 / 211054 | 94 | ![]() |
heart | 9 / 89626 | 100 | ![]() |
intestine | 27 / 234472 | 115 | ![]() |
kidney | 19 / 211777 | 89 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 26 / 207743 | 125 | ![]() |
lung | 38 / 336974 | 112 | ![]() |
lymph | 5 / 44270 | 112 | ![]() |
lymph node | 29 / 91610 | 316 | ![]() |
mammary gland | 20 / 153271 | 130 | ![]() |
mouth | 22 / 67052 | 328 | ![]() |
muscle | 7 / 107715 | 64 | ![]() |
nerve | 3 / 15768 | 190 | ![]() |
ovary | 15 / 102051 | 146 | ![]() |
pancreas | 7 / 214812 | 32 | ![]() |
parathyroid | 3 / 20539 | 146 | ![]() |
pharynx | 22 / 41328 | 532 | ![]() |
pituitary gland | 0 / 16585 | 0 | |
placenta | 19 / 280825 | 67 | ![]() |
prostate | 13 / 189345 | 68 | ![]() |
salivary gland | 4 / 20155 | 198 | ![]() |
skin | 25 / 210574 | 118 | ![]() |
spleen | 7 / 53952 | 129 | ![]() |
stomach | 14 / 96619 | 144 | ![]() |
testis | 67 / 330442 | 202 | ![]() |
thymus | 14 / 81131 | 172 | ![]() |
thyroid | 2 / 47473 | 42 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 8 / 52413 | 152 | ![]() |
umbilical cord | 2 / 13680 | 146 | ![]() |
uterus | 25 / 232878 | 107 | ![]() |
vascular | 9 / 51780 | 173 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201456_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 140.8 | ![]() |
Adipocyte | 8.95 | ![]() |
AdrenalCortex | 9.2 | ![]() |
Adrenalgland | 7.6 | ![]() |
Amygdala | 12.85 | ![]() |
Appendix | 8.6 | ![]() |
AtrioventricularNode | 6.2 | ![]() |
BDCA4+_DentriticCells | 51.25 | ![]() |
Bonemarrow | 8.65 | ![]() |
BronchialEpithelialCells | 42.1 | ![]() |
CD105+_Endothelial | 62.6 | ![]() |
CD14+_Monocytes | 9.65 | ![]() |
CD19+_BCells(neg._sel.) | 57.35 | ![]() |
CD33+_Myeloid | 11.65 | ![]() |
CD34+ | 76.35 | ![]() |
CD4+_Tcells | 87.35 | ![]() |
CD56+_NKCells | 105.15 | ![]() |
CD71+_EarlyErythroid | 12.9 | ![]() |
CD8+_Tcells | 76.05 | ![]() |
CardiacMyocytes | 18.75 | ![]() |
Caudatenucleus | 7.95 | ![]() |
Cerebellum | 6.9 | ![]() |
CerebellumPeduncles | 9.25 | ![]() |
CiliaryGanglion | 5.75 | ![]() |
CingulateCortex | 8.8 | ![]() |
Colorectaladenocarcinoma | 51.65 | ![]() |
DorsalRootGanglion | 6.3 | ![]() |
FetalThyroid | 8.35 | ![]() |
Fetalbrain | 9.1 | ![]() |
Fetalliver | 12.2 | ![]() |
Fetallung | 7.65 | ![]() |
GlobusPallidus | 6.15 | ![]() |
Heart | 10.25 | ![]() |
Hypothalamus | 19.6 | ![]() |
Kidney | 6.95 | ![]() |
Leukemia_chronicMyelogenousK-562 | 34.8 | ![]() |
Leukemia_promyelocytic-HL-60 | 43.95 | ![]() |
Leukemialymphoblastic(MOLT-4) | 72.7 | ![]() |
Liver | 11.25 | ![]() |
Lung | 9.15 | ![]() |
Lymphnode | 29.1 | ![]() |
Lymphoma_burkitts(Daudi) | 78.3 | ![]() |
Lymphoma_burkitts(Raji) | 13.15 | ![]() |
MedullaOblongata | 7.65 | ![]() |
OccipitalLobe | 8.35 | ![]() |
OlfactoryBulb | 6.9 | ![]() |
Ovary | 5.5 | ![]() |
Pancreas | 8.25 | ![]() |
PancreaticIslet | 8.8 | ![]() |
ParietalLobe | 9.3 | ![]() |
Pituitary | 15.6 | ![]() |
Placenta | 9.5 | ![]() |
Pons | 8.15 | ![]() |
PrefrontalCortex | 11.95 | ![]() |
Prostate | 11 | ![]() |
Salivarygland | 7.1 | ![]() |
SkeletalMuscle | 10 | ![]() |
Skin | 6.55 | ![]() |
SmoothMuscle | 13.55 | ![]() |
Spinalcord | 9.45 | ![]() |
SubthalamicNucleus | 7.2 | ![]() |
SuperiorCervicalGanglion | 9.55 | ![]() |
TemporalLobe | 7.55 | ![]() |
Testis | 7.2 | ![]() |
TestisGermCell | 7.65 | ![]() |
TestisIntersitial | 6.9 | ![]() |
TestisLeydigCell | 8.45 | ![]() |
TestisSeminiferousTubule | 7.05 | ![]() |
Thalamus | 8.8 | ![]() |
Thymus | 49.05 | ![]() |
Thyroid | 13.7 | ![]() |
Tongue | 8.35 | ![]() |
Tonsil | 11.65 | ![]() |
Trachea | 7.1 | ![]() |
TrigeminalGanglion | 8.45 | ![]() |
Uterus | 13.05 | ![]() |
UterusCorpus | 8 | ![]() |
WholeBlood | 19.55 | ![]() |
Wholebrain | 8.8 | ![]() |
colon | 20.9 | ![]() |
pineal_day | 13.28 | ![]() |
pineal_night | 13.24 | ![]() |
retina | 10.775 | ![]() |
small_intestine | 44.7 | ![]() |
- Probe name: A_23_P320658
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 8.59 ± 0.34 | ![]() ![]() ![]() |
Basal Forebrain | 8.59 ± 0.14 | ![]() ![]() ![]() |
Basal Part of Pons | 8.65 ± 0.18 | ![]() ![]() ![]() |
Cerebellar Cortex | 8.94 ± 0.11 | ![]() ![]() ![]() |
Cerebellar Nuclei | 8.92 ± 0.2 | ![]() ![]() ![]() |
Claustrum | 8.76 ± 0.43 | ![]() ![]() ![]() |
Epithalamus | 8.85 ± 0.23 | ![]() ![]() ![]() |
Frontal Lobe | 8.72 ± 0.27 | ![]() ![]() ![]() |
Globus Pallidus | 8.99 ± 0.31 | ![]() ![]() ![]() |
Hypothalamus | 9.18 ± 0.54 | ![]() ![]() ![]() |
Insula | 8.68 ± 0.36 | ![]() ![]() ![]() |
Limbic Lobe | 8.69 ± 0.24 | ![]() ![]() ![]() |
Mesencephalon | 8.85 ± 0.34 | ![]() ![]() ![]() |
Myelencephalon | 8.71 ± 0.25 | ![]() ![]() ![]() |
Occipital Lobe | 8.8 ± 0.25 | ![]() ![]() ![]() |
Parietal Lobe | 8.7 ± 0.3 | ![]() ![]() ![]() |
Pontine Tegmentum | 8.75 ± 0.25 | ![]() ![]() ![]() |
Striatum | 8.65 ± 0.35 | ![]() ![]() ![]() |
Subthalamus | 8.91 ± 0.26 | ![]() ![]() ![]() |
Temporal Lobe | 8.66 ± 0.21 | ![]() ![]() ![]() |
Thalamus | 8.75 ± 0.22 | ![]() ![]() ![]() |
White Matter | 9.77 ± 0.1 | ![]() ![]() ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
BUB3_HUMAN_140 | 10 | 140 | 149 | VYTLSVSGDR | PRIDE |
BUB3_HUMAN_315 | 14 | 315 | 328 | QVTDAETKPKSPCT | PRIDE |
PAp00005063 | 30 | 51 | 80 | LKYQHTGAVLDCAFYDPTHAWSGGLDHQLK | Peptide Atlas |