Annotation Detail for BUB3
Basic Information Top
| Gene Symbol: | BUB3 ( BUB3L,hBUB3 ) |
|---|---|
| Gene Full Name: | budding uninhibited by benzimidazoles 3 homolog (yeast) |
| Band: | 10q26.13 |
| Quick Links | Entrez ID:9184; OMIM: 603719; Uniprot ID:BUB3_HUMAN; ENSEMBL ID: ENSG00000154473; HGNC ID: 1151 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.418533
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 7 / 70761 | 98 | |
| blastocyst | 21 / 62319 | 336 | |
| fetus | 65 / 564012 | 115 | |
| neonate | 5 / 31097 | 160 | |
| infant | 6 / 23620 | 254 | |
| juvenile | 3 / 55556 | 53 | |
| adult | 196 / 1939121 | 101 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 5 / 12794 | 390 | |
| bladder carcinoma | 5 / 17475 | 286 | |
| breast (mammary gland) tumor | 16 / 94178 | 169 | |
| cervical tumor | 2 / 34366 | 58 | |
| chondrosarcoma | 8 / 82823 | 96 | |
| colorectal tumor | 21 / 114246 | 183 | |
| esophageal tumor | 1 / 17290 | 57 | |
| gastrointestinal tumor | 15 / 119369 | 125 | |
| germ cell tumor | 36 / 263845 | 136 | |
| glioma | 9 / 106883 | 84 | |
| head and neck tumor | 26 / 136302 | 190 | |
| kidney tumor | 8 / 68959 | 116 | |
| leukemia | 13 / 95842 | 135 | |
| liver tumor | 20 / 96359 | 207 | |
| lung tumor | 17 / 103127 | 164 | |
| lymphoma | 11 / 71755 | 153 | |
| non-neoplasia | 8 / 97250 | 82 | |
| normal | 389 / 3360307 | 115 | |
| ovarian tumor | 12 / 76682 | 156 | |
| pancreatic tumor | 2 / 104616 | 19 | |
| primitive neuroectodermal tumor of the CNS | 20 / 125680 | 159 | |
| prostate cancer | 6 / 102680 | 58 | |
| retinoblastoma | 6 / 46356 | 129 | |
| skin tumor | 17 / 124949 | 136 | |
| soft tissue/muscle tissue tumor | 14 / 125191 | 111 | |
| uterine tumor | 6 / 90257 | 66 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 8 / 33197 | 240 | |
| ascites | 5 / 40015 | 124 | |
| bladder | 9 / 29757 | 302 | |
| blood | 15 / 123478 | 121 | |
| bone | 8 / 71655 | 111 | |
| bone marrow | 15 / 48801 | 307 | |
| brain | 169 / 1100989 | 153 | |
| cervix | 2 / 48171 | 41 | |
| connective tissue | 17 / 149255 | 113 | |
| ear | 1 / 16212 | 61 | |
| embryonic tissue | 43 / 215722 | 199 | |
| esophagus | 1 / 20209 | 49 | |
| eye | 20 / 211054 | 94 | |
| heart | 9 / 89626 | 100 | |
| intestine | 27 / 234472 | 115 | |
| kidney | 19 / 211777 | 89 | |
| larynx | 0 / 24145 | 0 | |
| liver | 26 / 207743 | 125 | |
| lung | 38 / 336974 | 112 | |
| lymph | 5 / 44270 | 112 | |
| lymph node | 29 / 91610 | 316 | |
| mammary gland | 20 / 153271 | 130 | |
| mouth | 22 / 67052 | 328 | |
| muscle | 7 / 107715 | 64 | |
| nerve | 3 / 15768 | 190 | |
| ovary | 15 / 102051 | 146 | |
| pancreas | 7 / 214812 | 32 | |
| parathyroid | 3 / 20539 | 146 | |
| pharynx | 22 / 41328 | 532 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 19 / 280825 | 67 | |
| prostate | 13 / 189345 | 68 | |
| salivary gland | 4 / 20155 | 198 | |
| skin | 25 / 210574 | 118 | |
| spleen | 7 / 53952 | 129 | |
| stomach | 14 / 96619 | 144 | |
| testis | 67 / 330442 | 202 | |
| thymus | 14 / 81131 | 172 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 8 / 52413 | 152 | |
| umbilical cord | 2 / 13680 | 146 | |
| uterus | 25 / 232878 | 107 | |
| vascular | 9 / 51780 | 173 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201456_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 140.8 | |
| Adipocyte | 8.95 | |
| AdrenalCortex | 9.2 | |
| Adrenalgland | 7.6 | |
| Amygdala | 12.85 | |
| Appendix | 8.6 | |
| AtrioventricularNode | 6.2 | |
| BDCA4+_DentriticCells | 51.25 | |
| Bonemarrow | 8.65 | |
| BronchialEpithelialCells | 42.1 | |
| CD105+_Endothelial | 62.6 | |
| CD14+_Monocytes | 9.65 | |
| CD19+_BCells(neg._sel.) | 57.35 | |
| CD33+_Myeloid | 11.65 | |
| CD34+ | 76.35 | |
| CD4+_Tcells | 87.35 | |
| CD56+_NKCells | 105.15 | |
| CD71+_EarlyErythroid | 12.9 | |
| CD8+_Tcells | 76.05 | |
| CardiacMyocytes | 18.75 | |
| Caudatenucleus | 7.95 | |
| Cerebellum | 6.9 | |
| CerebellumPeduncles | 9.25 | |
| CiliaryGanglion | 5.75 | |
| CingulateCortex | 8.8 | |
| Colorectaladenocarcinoma | 51.65 | |
| DorsalRootGanglion | 6.3 | |
| FetalThyroid | 8.35 | |
| Fetalbrain | 9.1 | |
| Fetalliver | 12.2 | |
| Fetallung | 7.65 | |
| GlobusPallidus | 6.15 | |
| Heart | 10.25 | |
| Hypothalamus | 19.6 | |
| Kidney | 6.95 | |
| Leukemia_chronicMyelogenousK-562 | 34.8 | |
| Leukemia_promyelocytic-HL-60 | 43.95 | |
| Leukemialymphoblastic(MOLT-4) | 72.7 | |
| Liver | 11.25 | |
| Lung | 9.15 | |
| Lymphnode | 29.1 | |
| Lymphoma_burkitts(Daudi) | 78.3 | |
| Lymphoma_burkitts(Raji) | 13.15 | |
| MedullaOblongata | 7.65 | |
| OccipitalLobe | 8.35 | |
| OlfactoryBulb | 6.9 | |
| Ovary | 5.5 | |
| Pancreas | 8.25 | |
| PancreaticIslet | 8.8 | |
| ParietalLobe | 9.3 | |
| Pituitary | 15.6 | |
| Placenta | 9.5 | |
| Pons | 8.15 | |
| PrefrontalCortex | 11.95 | |
| Prostate | 11 | |
| Salivarygland | 7.1 | |
| SkeletalMuscle | 10 | |
| Skin | 6.55 | |
| SmoothMuscle | 13.55 | |
| Spinalcord | 9.45 | |
| SubthalamicNucleus | 7.2 | |
| SuperiorCervicalGanglion | 9.55 | |
| TemporalLobe | 7.55 | |
| Testis | 7.2 | |
| TestisGermCell | 7.65 | |
| TestisIntersitial | 6.9 | |
| TestisLeydigCell | 8.45 | |
| TestisSeminiferousTubule | 7.05 | |
| Thalamus | 8.8 | |
| Thymus | 49.05 | |
| Thyroid | 13.7 | |
| Tongue | 8.35 | |
| Tonsil | 11.65 | |
| Trachea | 7.1 | |
| TrigeminalGanglion | 8.45 | |
| Uterus | 13.05 | |
| UterusCorpus | 8 | |
| WholeBlood | 19.55 | |
| Wholebrain | 8.8 | |
| colon | 20.9 | |
| pineal_day | 13.28 | |
| pineal_night | 13.24 | |
| retina | 10.775 | |
| small_intestine | 44.7 |
- Probe name: A_23_P320658
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 8.59 ± 0.34 | |
| Basal Forebrain | 8.59 ± 0.14 | |
| Basal Part of Pons | 8.65 ± 0.18 | |
| Cerebellar Cortex | 8.94 ± 0.11 | |
| Cerebellar Nuclei | 8.92 ± 0.2 | |
| Claustrum | 8.76 ± 0.43 | |
| Epithalamus | 8.85 ± 0.23 | |
| Frontal Lobe | 8.72 ± 0.27 | |
| Globus Pallidus | 8.99 ± 0.31 | |
| Hypothalamus | 9.18 ± 0.54 | |
| Insula | 8.68 ± 0.36 | |
| Limbic Lobe | 8.69 ± 0.24 | |
| Mesencephalon | 8.85 ± 0.34 | |
| Myelencephalon | 8.71 ± 0.25 | |
| Occipital Lobe | 8.8 ± 0.25 | |
| Parietal Lobe | 8.7 ± 0.3 | |
| Pontine Tegmentum | 8.75 ± 0.25 | |
| Striatum | 8.65 ± 0.35 | |
| Subthalamus | 8.91 ± 0.26 | |
| Temporal Lobe | 8.66 ± 0.21 | |
| Thalamus | 8.75 ± 0.22 | |
| White Matter | 9.77 ± 0.1 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| BUB3_HUMAN_140 | 10 | 140 | 149 | VYTLSVSGDR | PRIDE |
| BUB3_HUMAN_315 | 14 | 315 | 328 | QVTDAETKPKSPCT | PRIDE |
| PAp00005063 | 30 | 51 | 80 | LKYQHTGAVLDCAFYDPTHAWSGGLDHQLK | Peptide Atlas |




Mouse Brain ISH