Annotation Detail for DLG5
Basic Information Top
| Gene Symbol: | DLG5 ( KIAA0583,LP-DLG,P-DLG5,PDLG ) |
|---|---|
| Gene Full Name: | discs, large homolog 5 (Drosophila) |
| Band: | 10q22.3 |
| Quick Links | Entrez ID:9231; OMIM: 604090; Uniprot ID:DLG5_HUMAN; ENSEMBL ID: ENSG00000151208; HGNC ID: 2904 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.652690
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 8 / 70761 | 113 | |
| blastocyst | 8 / 62319 | 128 | |
| fetus | 50 / 564012 | 88 | |
| neonate | 0 / 31097 | 0 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 1 / 55556 | 17 | |
| adult | 215 / 1939121 | 110 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 0 / 12794 | 0 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 31 / 94178 | 329 | |
| cervical tumor | 2 / 34366 | 58 | |
| chondrosarcoma | 6 / 82823 | 72 | |
| colorectal tumor | 14 / 114246 | 122 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 9 / 119369 | 75 | |
| germ cell tumor | 10 / 263845 | 37 | |
| glioma | 8 / 106883 | 74 | |
| head and neck tumor | 23 / 136302 | 168 | |
| kidney tumor | 1 / 68959 | 14 | |
| leukemia | 3 / 95842 | 31 | |
| liver tumor | 2 / 96359 | 20 | |
| lung tumor | 0 / 103127 | 0 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 1 / 97250 | 10 | |
| normal | 240 / 3360307 | 71 | |
| ovarian tumor | 4 / 76682 | 52 | |
| pancreatic tumor | 6 / 104616 | 57 | |
| primitive neuroectodermal tumor of the CNS | 6 / 125680 | 47 | |
| prostate cancer | 7 / 102680 | 68 | |
| retinoblastoma | 3 / 46356 | 64 | |
| skin tumor | 0 / 124949 | 0 | |
| soft tissue/muscle tissue tumor | 6 / 125191 | 47 | |
| uterine tumor | 15 / 90257 | 166 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 0 / 13106 | 0 | |
| adrenal gland | 0 / 33197 | 0 | |
| ascites | 0 / 40015 | 0 | |
| bladder | 1 / 29757 | 33 | |
| blood | 2 / 123478 | 16 | |
| bone | 3 / 71655 | 41 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 58 / 1100989 | 52 | |
| cervix | 2 / 48171 | 41 | |
| connective tissue | 5 / 149255 | 33 | |
| ear | 1 / 16212 | 61 | |
| embryonic tissue | 20 / 215722 | 92 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 14 / 211054 | 66 | |
| heart | 4 / 89626 | 44 | |
| intestine | 20 / 234472 | 85 | |
| kidney | 4 / 211777 | 18 | |
| larynx | 2 / 24145 | 82 | |
| liver | 6 / 207743 | 28 | |
| lung | 32 / 336974 | 94 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 0 / 91610 | 0 | |
| mammary gland | 36 / 153271 | 234 | |
| mouth | 9 / 67052 | 134 | |
| muscle | 8 / 107715 | 74 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 5 / 102051 | 48 | |
| pancreas | 10 / 214812 | 46 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 1 / 41328 | 24 | |
| pituitary gland | 0 / 16585 | 0 | |
| placenta | 60 / 280825 | 213 | |
| prostate | 20 / 189345 | 105 | |
| salivary gland | 9 / 20155 | 446 | |
| skin | 5 / 210574 | 23 | |
| spleen | 0 / 53952 | 0 | |
| stomach | 7 / 96619 | 72 | |
| testis | 13 / 330442 | 39 | |
| thymus | 2 / 81131 | 24 | |
| thyroid | 2 / 47473 | 42 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 1 / 52413 | 19 | |
| umbilical cord | 2 / 13680 | 146 | |
| uterus | 26 / 232878 | 111 | |
| vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201681_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 11.3 | |
| Adipocyte | 28.4 | |
| AdrenalCortex | 427.3 | |
| Adrenalgland | 193.95 | |
| Amygdala | 15.6 | |
| Appendix | 19 | |
| AtrioventricularNode | 11.4 | |
| BDCA4+_DentriticCells | 7.85 | |
| Bonemarrow | 10.55 | |
| BronchialEpithelialCells | 117.8 | |
| CD105+_Endothelial | 9.45 | |
| CD14+_Monocytes | 7.45 | |
| CD19+_BCells(neg._sel.) | 9.4 | |
| CD33+_Myeloid | 11.85 | |
| CD34+ | 11.75 | |
| CD4+_Tcells | 9.95 | |
| CD56+_NKCells | 36.3 | |
| CD71+_EarlyErythroid | 8.95 | |
| CD8+_Tcells | 8.9 | |
| CardiacMyocytes | 26.35 | |
| Caudatenucleus | 9.05 | |
| Cerebellum | 14.05 | |
| CerebellumPeduncles | 11.15 | |
| CiliaryGanglion | 8.3 | |
| CingulateCortex | 11.75 | |
| Colorectaladenocarcinoma | 76.3 | |
| DorsalRootGanglion | 10.5 | |
| FetalThyroid | 46.8 | |
| Fetalbrain | 450.15 | |
| Fetalliver | 11.45 | |
| Fetallung | 58.55 | |
| GlobusPallidus | 10.8 | |
| Heart | 12.95 | |
| Hypothalamus | 40.65 | |
| Kidney | 8.85 | |
| Leukemia_chronicMyelogenousK-562 | 17.55 | |
| Leukemia_promyelocytic-HL-60 | 7.55 | |
| Leukemialymphoblastic(MOLT-4) | 13.55 | |
| Liver | 14.4 | |
| Lung | 15.35 | |
| Lymphnode | 8.2 | |
| Lymphoma_burkitts(Daudi) | 10.95 | |
| Lymphoma_burkitts(Raji) | 13.05 | |
| MedullaOblongata | 10.1 | |
| OccipitalLobe | 12.7 | |
| OlfactoryBulb | 18.55 | |
| Ovary | 10.35 | |
| Pancreas | 8.6 | |
| PancreaticIslet | 21.05 | |
| ParietalLobe | 10.3 | |
| Pituitary | 128.9 | |
| Placenta | 1499.35 | |
| Pons | 10.25 | |
| PrefrontalCortex | 14.2 | |
| Prostate | 162.2 | |
| Salivarygland | 12.6 | |
| SkeletalMuscle | 12.2 | |
| Skin | 30.75 | |
| SmoothMuscle | 61.25 | |
| Spinalcord | 31.55 | |
| SubthalamicNucleus | 10.65 | |
| SuperiorCervicalGanglion | 16.15 | |
| TemporalLobe | 9.05 | |
| Testis | 13.45 | |
| TestisGermCell | 23.55 | |
| TestisIntersitial | 8.7 | |
| TestisLeydigCell | 11.85 | |
| TestisSeminiferousTubule | 8.55 | |
| Thalamus | 11.95 | |
| Thymus | 12.25 | |
| Thyroid | 239.2 | |
| Tongue | 13 | |
| Tonsil | 12.6 | |
| Trachea | 28.1 | |
| TrigeminalGanglion | 13 | |
| Uterus | 110.05 | |
| UterusCorpus | 11.6 | |
| WholeBlood | 10.3 | |
| Wholebrain | 11.9 | |
| colon | 13.85 | |
| pineal_day | 77.6 | |
| pineal_night | 111.12 | |
| retina | 50 | |
| small_intestine | 28.8 |
- Probe name: A_23_P161209
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 5.95 ± 0.47 | |
| Basal Forebrain | 5.76 ± 0.37 | |
| Basal Part of Pons | 5.88 ± 0.41 | |
| Cerebellar Cortex | 5.53 ± 0.44 | |
| Cerebellar Nuclei | 5.86 ± 0.39 | |
| Claustrum | 5.92 ± 0.57 | |
| Epithalamus | 5.71 ± 0.68 | |
| Frontal Lobe | 5.5 ± 0.44 | |
| Globus Pallidus | 6.4 ± 0.37 | |
| Hypothalamus | 5.75 ± 0.39 | |
| Insula | 5.55 ± 0.39 | |
| Limbic Lobe | 5.93 ± 0.63 | |
| Mesencephalon | 5.79 ± 0.51 | |
| Myelencephalon | 5.78 ± 0.52 | |
| Occipital Lobe | 6.42 ± 0.63 | |
| Parietal Lobe | 5.77 ± 0.48 | |
| Pontine Tegmentum | 5.47 ± 0.52 | |
| Striatum | 5.17 ± 0.62 | |
| Subthalamus | 5.08 ± 0.4 | |
| Temporal Lobe | 5.68 ± 0.47 | |
| Thalamus | 5.79 ± 0.4 | |
| White Matter | 6.56 ± 0.66 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Dlg5 | CB | Cerebellum | 4.42 | |
| 6.97 | ||||
| Dlg5 | CTX | Cerebral cortex | 23.59 | |
| 17.74 | ||||
| Dlg5 | HIP | Hippocampal region | 12.98 | |
| 13.55 | ||||
| Dlg5 | HPF | Hippocampal formation | 12.56 | |
| 11.53 | ||||
| Dlg5 | HY | Hypothalamus | 5.56 | |
| 4.14 | ||||
| Dlg5 | LSX | Lateral septal complex | 4.41 | |
| 3.22 | ||||
| Dlg5 | MB | Midbrain | 6.17 | |
| 8.02 | ||||
| Dlg5 | MY | Medulla | 3.05 | |
| 4.21 | ||||
| Dlg5 | OLF | Olfactory bulb | 14.2 | |
| 10.45 | ||||
| Dlg5 | P | Pons | 2.15 | |
| 2.38 | ||||
| Dlg5 | PAL | Pallidum | 6.06 | |
| 4.6 | ||||
| Dlg5 | RHP | Retrohippocampal region | 11.76 | |
| 8.55 | ||||
| Dlg5 | sAMY | Striatum-like amygdalar nuclei | 14.22 | |
| 9.98 | ||||
| Dlg5 | STR | Striatum | 5.81 | |
| 4.3 | ||||
| Dlg5 | STRd | Striatum dorsal region | 4.37 | |
| 3.59 | ||||
| Dlg5 | STRv | Striatum ventral region | 6.87 | |
| 4.47 | ||||
| Dlg5 | TH | Thalamus | 22.61 | |
| 27.09 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00096257 | 35 | 856 | 890 | KEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASER | Peptide Atlas |



