Annotation Detail for DLG5
Basic Information Top
Gene Symbol: | DLG5 ( KIAA0583,LP-DLG,P-DLG5,PDLG ) |
---|---|
Gene Full Name: | discs, large homolog 5 (Drosophila) |
Band: | 10q22.3 |
Quick Links | Entrez ID:9231; OMIM: 604090; Uniprot ID:DLG5_HUMAN; ENSEMBL ID: ENSG00000151208; HGNC ID: 2904 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.652690
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
embryoid body | 8 / 70761 | 113 | |
blastocyst | 8 / 62319 | 128 | |
fetus | 50 / 564012 | 88 | |
neonate | 0 / 31097 | 0 | |
infant | 1 / 23620 | 42 | |
juvenile | 1 / 55556 | 17 | |
adult | 215 / 1939121 | 110 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 31 / 94178 | 329 | |
cervical tumor | 2 / 34366 | 58 | |
chondrosarcoma | 6 / 82823 | 72 | |
colorectal tumor | 14 / 114246 | 122 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 9 / 119369 | 75 | |
germ cell tumor | 10 / 263845 | 37 | |
glioma | 8 / 106883 | 74 | |
head and neck tumor | 23 / 136302 | 168 | |
kidney tumor | 1 / 68959 | 14 | |
leukemia | 3 / 95842 | 31 | |
liver tumor | 2 / 96359 | 20 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 1 / 97250 | 10 | |
normal | 240 / 3360307 | 71 | |
ovarian tumor | 4 / 76682 | 52 | |
pancreatic tumor | 6 / 104616 | 57 | |
primitive neuroectodermal tumor of the CNS | 6 / 125680 | 47 | |
prostate cancer | 7 / 102680 | 68 | |
retinoblastoma | 3 / 46356 | 64 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 6 / 125191 | 47 | |
uterine tumor | 15 / 90257 | 166 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 1 / 29757 | 33 | |
blood | 2 / 123478 | 16 | |
bone | 3 / 71655 | 41 | |
bone marrow | 1 / 48801 | 20 | |
brain | 58 / 1100989 | 52 | |
cervix | 2 / 48171 | 41 | |
connective tissue | 5 / 149255 | 33 | |
ear | 1 / 16212 | 61 | |
embryonic tissue | 20 / 215722 | 92 | |
esophagus | 0 / 20209 | 0 | |
eye | 14 / 211054 | 66 | |
heart | 4 / 89626 | 44 | |
intestine | 20 / 234472 | 85 | |
kidney | 4 / 211777 | 18 | |
larynx | 2 / 24145 | 82 | |
liver | 6 / 207743 | 28 | |
lung | 32 / 336974 | 94 | |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 36 / 153271 | 234 | |
mouth | 9 / 67052 | 134 | |
muscle | 8 / 107715 | 74 | |
nerve | 0 / 15768 | 0 | |
ovary | 5 / 102051 | 48 | |
pancreas | 10 / 214812 | 46 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 1 / 41328 | 24 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 60 / 280825 | 213 | |
prostate | 20 / 189345 | 105 | |
salivary gland | 9 / 20155 | 446 | |
skin | 5 / 210574 | 23 | |
spleen | 0 / 53952 | 0 | |
stomach | 7 / 96619 | 72 | |
testis | 13 / 330442 | 39 | |
thymus | 2 / 81131 | 24 | |
thyroid | 2 / 47473 | 42 | |
tonsil | 0 / 16999 | 0 | |
trachea | 1 / 52413 | 19 | |
umbilical cord | 2 / 13680 | 146 | |
uterus | 26 / 232878 | 111 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201681_s_at
Cell line | Expression level | Expression bar |
---|---|---|
721_B_lymphoblasts | 11.3 | |
Adipocyte | 28.4 | |
AdrenalCortex | 427.3 | |
Adrenalgland | 193.95 | |
Amygdala | 15.6 | |
Appendix | 19 | |
AtrioventricularNode | 11.4 | |
BDCA4+_DentriticCells | 7.85 | |
Bonemarrow | 10.55 | |
BronchialEpithelialCells | 117.8 | |
CD105+_Endothelial | 9.45 | |
CD14+_Monocytes | 7.45 | |
CD19+_BCells(neg._sel.) | 9.4 | |
CD33+_Myeloid | 11.85 | |
CD34+ | 11.75 | |
CD4+_Tcells | 9.95 | |
CD56+_NKCells | 36.3 | |
CD71+_EarlyErythroid | 8.95 | |
CD8+_Tcells | 8.9 | |
CardiacMyocytes | 26.35 | |
Caudatenucleus | 9.05 | |
Cerebellum | 14.05 | |
CerebellumPeduncles | 11.15 | |
CiliaryGanglion | 8.3 | |
CingulateCortex | 11.75 | |
Colorectaladenocarcinoma | 76.3 | |
DorsalRootGanglion | 10.5 | |
FetalThyroid | 46.8 | |
Fetalbrain | 450.15 | |
Fetalliver | 11.45 | |
Fetallung | 58.55 | |
GlobusPallidus | 10.8 | |
Heart | 12.95 | |
Hypothalamus | 40.65 | |
Kidney | 8.85 | |
Leukemia_chronicMyelogenousK-562 | 17.55 | |
Leukemia_promyelocytic-HL-60 | 7.55 | |
Leukemialymphoblastic(MOLT-4) | 13.55 | |
Liver | 14.4 | |
Lung | 15.35 | |
Lymphnode | 8.2 | |
Lymphoma_burkitts(Daudi) | 10.95 | |
Lymphoma_burkitts(Raji) | 13.05 | |
MedullaOblongata | 10.1 | |
OccipitalLobe | 12.7 | |
OlfactoryBulb | 18.55 | |
Ovary | 10.35 | |
Pancreas | 8.6 | |
PancreaticIslet | 21.05 | |
ParietalLobe | 10.3 | |
Pituitary | 128.9 | |
Placenta | 1499.35 | |
Pons | 10.25 | |
PrefrontalCortex | 14.2 | |
Prostate | 162.2 | |
Salivarygland | 12.6 | |
SkeletalMuscle | 12.2 | |
Skin | 30.75 | |
SmoothMuscle | 61.25 | |
Spinalcord | 31.55 | |
SubthalamicNucleus | 10.65 | |
SuperiorCervicalGanglion | 16.15 | |
TemporalLobe | 9.05 | |
Testis | 13.45 | |
TestisGermCell | 23.55 | |
TestisIntersitial | 8.7 | |
TestisLeydigCell | 11.85 | |
TestisSeminiferousTubule | 8.55 | |
Thalamus | 11.95 | |
Thymus | 12.25 | |
Thyroid | 239.2 | |
Tongue | 13 | |
Tonsil | 12.6 | |
Trachea | 28.1 | |
TrigeminalGanglion | 13 | |
Uterus | 110.05 | |
UterusCorpus | 11.6 | |
WholeBlood | 10.3 | |
Wholebrain | 11.9 | |
colon | 13.85 | |
pineal_day | 77.6 | |
pineal_night | 111.12 | |
retina | 50 | |
small_intestine | 28.8 |
Human Whole Brain Microarrayview in Allen Brain Atlas
- Probe name: A_23_P161209
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.95 ± 0.47 | |
Basal Forebrain | 5.76 ± 0.37 | |
Basal Part of Pons | 5.88 ± 0.41 | |
Cerebellar Cortex | 5.53 ± 0.44 | |
Cerebellar Nuclei | 5.86 ± 0.39 | |
Claustrum | 5.92 ± 0.57 | |
Epithalamus | 5.71 ± 0.68 | |
Frontal Lobe | 5.5 ± 0.44 | |
Globus Pallidus | 6.4 ± 0.37 | |
Hypothalamus | 5.75 ± 0.39 | |
Insula | 5.55 ± 0.39 | |
Limbic Lobe | 5.93 ± 0.63 | |
Mesencephalon | 5.79 ± 0.51 | |
Myelencephalon | 5.78 ± 0.52 | |
Occipital Lobe | 6.42 ± 0.63 | |
Parietal Lobe | 5.77 ± 0.48 | |
Pontine Tegmentum | 5.47 ± 0.52 | |
Striatum | 5.17 ± 0.62 | |
Subthalamus | 5.08 ± 0.4 | |
Temporal Lobe | 5.68 ± 0.47 | |
Thalamus | 5.79 ± 0.4 | |
White Matter | 6.56 ± 0.66 |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Dlg5 | CB | Cerebellum | 4.42 | |
6.97 | ||||
Dlg5 | CTX | Cerebral cortex | 23.59 | |
17.74 | ||||
Dlg5 | HIP | Hippocampal region | 12.98 | |
13.55 | ||||
Dlg5 | HPF | Hippocampal formation | 12.56 | |
11.53 | ||||
Dlg5 | HY | Hypothalamus | 5.56 | |
4.14 | ||||
Dlg5 | LSX | Lateral septal complex | 4.41 | |
3.22 | ||||
Dlg5 | MB | Midbrain | 6.17 | |
8.02 | ||||
Dlg5 | MY | Medulla | 3.05 | |
4.21 | ||||
Dlg5 | OLF | Olfactory bulb | 14.2 | |
10.45 | ||||
Dlg5 | P | Pons | 2.15 | |
2.38 | ||||
Dlg5 | PAL | Pallidum | 6.06 | |
4.6 | ||||
Dlg5 | RHP | Retrohippocampal region | 11.76 | |
8.55 | ||||
Dlg5 | sAMY | Striatum-like amygdalar nuclei | 14.22 | |
9.98 | ||||
Dlg5 | STR | Striatum | 5.81 | |
4.3 | ||||
Dlg5 | STRd | Striatum dorsal region | 4.37 | |
3.59 | ||||
Dlg5 | STRv | Striatum ventral region | 6.87 | |
4.47 | ||||
Dlg5 | TH | Thalamus | 22.61 | |
27.09 |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00096257 | 35 | 856 | 890 | KEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASER | Peptide Atlas |