Annotation Detail for KCNB2


Gene Symbol: | KCNB2 ( KV2.2 ) |
---|---|
Gene Full Name: | potassium voltage-gated channel, Shab-related subfamily, member 2 |
Band: | 8q21.11 |
Quick Links | Entrez ID:9312; OMIM: 607738; Uniprot ID:KCNB2_HUMAN; ENSEMBL ID: ENSG00000182674; HGNC ID: 6232 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.661102
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 0 / 70761 | 0 | |
blastocyst | 0 / 62319 | 0 | |
fetus | 1 / 564012 | 1 | ![]() |
neonate | 0 / 31097 | 0 | |
infant | 1 / 23620 | 42 | ![]() |
juvenile | 0 / 55556 | 0 | |
adult | 0 / 1939121 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 0 / 12794 | 0 | |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 0 / 94178 | 0 | |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 0 / 82823 | 0 | |
colorectal tumor | 0 / 114246 | 0 | |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 0 / 119369 | 0 | |
germ cell tumor | 0 / 263845 | 0 | |
glioma | 0 / 106883 | 0 | |
head and neck tumor | 0 / 136302 | 0 | |
kidney tumor | 0 / 68959 | 0 | |
leukemia | 0 / 95842 | 0 | |
liver tumor | 0 / 96359 | 0 | |
lung tumor | 0 / 103127 | 0 | |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 0 / 97250 | 0 | |
normal | 3 / 3360307 | 0 | |
ovarian tumor | 0 / 76682 | 0 | |
pancreatic tumor | 0 / 104616 | 0 | |
primitive neuroectodermal tumor of the CNS | 1 / 125680 | 7 | ![]() |
prostate cancer | 0 / 102680 | 0 | |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 0 / 124949 | 0 | |
soft tissue/muscle tissue tumor | 0 / 125191 | 0 | |
uterine tumor | 0 / 90257 | 0 |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 0 / 13106 | 0 | |
adrenal gland | 0 / 33197 | 0 | |
ascites | 0 / 40015 | 0 | |
bladder | 0 / 29757 | 0 | |
blood | 0 / 123478 | 0 | |
bone | 0 / 71655 | 0 | |
bone marrow | 0 / 48801 | 0 | |
brain | 4 / 1100989 | 3 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 0 / 149255 | 0 | |
ear | 0 / 16212 | 0 | |
embryonic tissue | 0 / 215722 | 0 | |
esophagus | 0 / 20209 | 0 | |
eye | 0 / 211054 | 0 | |
heart | 0 / 89626 | 0 | |
intestine | 0 / 234472 | 0 | |
kidney | 0 / 211777 | 0 | |
larynx | 0 / 24145 | 0 | |
liver | 0 / 207743 | 0 | |
lung | 0 / 336974 | 0 | |
lymph | 0 / 44270 | 0 | |
lymph node | 0 / 91610 | 0 | |
mammary gland | 0 / 153271 | 0 | |
mouth | 0 / 67052 | 0 | |
muscle | 0 / 107715 | 0 | |
nerve | 0 / 15768 | 0 | |
ovary | 0 / 102051 | 0 | |
pancreas | 0 / 214812 | 0 | |
parathyroid | 0 / 20539 | 0 | |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 0 / 16585 | 0 | |
placenta | 0 / 280825 | 0 | |
prostate | 0 / 189345 | 0 | |
salivary gland | 0 / 20155 | 0 | |
skin | 0 / 210574 | 0 | |
spleen | 0 / 53952 | 0 | |
stomach | 0 / 96619 | 0 | |
testis | 0 / 330442 | 0 | |
thymus | 0 / 81131 | 0 | |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 0 / 52413 | 0 | |
umbilical cord | 0 / 13680 | 0 | |
uterus | 0 / 232878 | 0 | |
vascular | 0 / 51780 | 0 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 208172_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 5 | ![]() |
Adipocyte | 4 | ![]() |
AdrenalCortex | 5.45 | ![]() |
Adrenalgland | 3.65 | ![]() |
Amygdala | 4.2 | ![]() |
Appendix | 4.1 | ![]() |
AtrioventricularNode | 3.25 | ![]() |
BDCA4+_DentriticCells | 4.45 | ![]() |
Bonemarrow | 4 | ![]() |
BronchialEpithelialCells | 4 | ![]() |
CD105+_Endothelial | 4.05 | ![]() |
CD14+_Monocytes | 4.25 | ![]() |
CD19+_BCells(neg._sel.) | 4.3 | ![]() |
CD33+_Myeloid | 5.2 | ![]() |
CD34+ | 5.1 | ![]() |
CD4+_Tcells | 4.4 | ![]() |
CD56+_NKCells | 4.75 | ![]() |
CD71+_EarlyErythroid | 3.75 | ![]() |
CD8+_Tcells | 3.85 | ![]() |
CardiacMyocytes | 5.6 | ![]() |
Caudatenucleus | 3.65 | ![]() |
Cerebellum | 3.3 | ![]() |
CerebellumPeduncles | 4.55 | ![]() |
CiliaryGanglion | 3 | ![]() |
CingulateCortex | 4.8 | ![]() |
Colorectaladenocarcinoma | 4.05 | ![]() |
DorsalRootGanglion | 3.2 | ![]() |
FetalThyroid | 3.9 | ![]() |
Fetalbrain | 4.15 | ![]() |
Fetalliver | 3.5 | ![]() |
Fetallung | 3.4 | ![]() |
GlobusPallidus | 3.05 | ![]() |
Heart | 5.2 | ![]() |
Hypothalamus | 4.4 | ![]() |
Kidney | 3.3 | ![]() |
Leukemia_chronicMyelogenousK-562 | 4.55 | ![]() |
Leukemia_promyelocytic-HL-60 | 3.55 | ![]() |
Leukemialymphoblastic(MOLT-4) | 3.25 | ![]() |
Liver | 5.3 | ![]() |
Lung | 4.4 | ![]() |
Lymphnode | 3.5 | ![]() |
Lymphoma_burkitts(Daudi) | 5.3 | ![]() |
Lymphoma_burkitts(Raji) | 5.7 | ![]() |
MedullaOblongata | 3.7 | ![]() |
OccipitalLobe | 3.6 | ![]() |
OlfactoryBulb | 3.2 | ![]() |
Ovary | 2.75 | ![]() |
Pancreas | 3.2 | ![]() |
PancreaticIslet | 4.3 | ![]() |
ParietalLobe | 4.3 | ![]() |
Pituitary | 5.75 | ![]() |
Placenta | 4.1 | ![]() |
Pons | 3.9 | ![]() |
PrefrontalCortex | 5 | ![]() |
Prostate | 4.7 | ![]() |
Salivarygland | 3.95 | ![]() |
SkeletalMuscle | 4.75 | ![]() |
Skin | 3.25 | ![]() |
SmoothMuscle | 4.6 | ![]() |
Spinalcord | 6.9 | ![]() |
SubthalamicNucleus | 3.7 | ![]() |
SuperiorCervicalGanglion | 5.05 | ![]() |
TemporalLobe | 3.7 | ![]() |
Testis | 5 | ![]() |
TestisGermCell | 3.45 | ![]() |
TestisIntersitial | 3.55 | ![]() |
TestisLeydigCell | 5.05 | ![]() |
TestisSeminiferousTubule | 3.45 | ![]() |
Thalamus | 4.1 | ![]() |
Thymus | 3.15 | ![]() |
Thyroid | 5.05 | ![]() |
Tongue | 4.1 | ![]() |
Tonsil | 3.95 | ![]() |
Trachea | 3.4 | ![]() |
TrigeminalGanglion | 4.1 | ![]() |
Uterus | 3.3 | ![]() |
UterusCorpus | 6.65 | ![]() |
WholeBlood | 4.45 | ![]() |
Wholebrain | 3.4 | ![]() |
colon | 4 | ![]() |
pineal_day | 5 | ![]() |
pineal_night | 4.88 | ![]() |
retina | 4.875 | ![]() |
small_intestine | 3.85 | ![]() |
- Probe name: CUST_11328_PI416261804
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 6.22 ± 0.32 | ![]() ![]() ![]() |
Basal Forebrain | 5.77 ± 0.52 | ![]() ![]() ![]() |
Basal Part of Pons | 5.55 ± 0.41 | ![]() ![]() ![]() |
Cerebellar Cortex | 5.31 ± 0.47 | ![]() ![]() ![]() |
Cerebellar Nuclei | 4.98 ± 0.54 | ![]() ![]() ![]() |
Claustrum | 5.68 ± 0.49 | ![]() ![]() ![]() |
Epithalamus | 5.3 ± 0.77 | ![]() ![]() ![]() |
Frontal Lobe | 5.9 ± 0.56 | ![]() ![]() ![]() |
Globus Pallidus | 5.1 ± 1.26 | ![]() ![]() ![]() |
Hypothalamus | 6.15 ± 0.25 | ![]() ![]() ![]() |
Insula | 6.13 ± 0.24 | ![]() ![]() ![]() |
Limbic Lobe | 6.4 ± 0.53 | ![]() ![]() ![]() |
Mesencephalon | 6.01 ± 0.57 | ![]() ![]() ![]() |
Myelencephalon | 5.97 ± 0.65 | ![]() ![]() ![]() |
Occipital Lobe | 5.95 ± 0.69 | ![]() ![]() ![]() |
Parietal Lobe | 6.09 ± 0.63 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.95 ± 0.76 | ![]() ![]() ![]() |
Striatum | 5.98 ± 0.89 | ![]() ![]() ![]() |
Subthalamus | 5.95 ± 1.48 | ![]() ![]() ![]() |
Temporal Lobe | 6.1 ± 0.48 | ![]() ![]() ![]() |
Thalamus | 5.7 ± 0.69 | ![]() ![]() ![]() |
White Matter | 4.76 ± 0.8 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Kcnb2 | CB | Cerebellum | 0.5 | ![]() |
1.11 | ![]() | |||
Kcnb2 | CTX | Cerebral cortex | 7.9 | ![]() |
6.42 | ![]() | |||
Kcnb2 | HIP | Hippocampal region | 4.73 | ![]() |
5.67 | ![]() | |||
Kcnb2 | HPF | Hippocampal formation | 4 | ![]() |
4.2 | ![]() | |||
Kcnb2 | HY | Hypothalamus | 0.66 | ![]() |
0.67 | ![]() | |||
Kcnb2 | LSX | Lateral septal complex | 0.41 | ![]() |
0.89 | ![]() | |||
Kcnb2 | MB | Midbrain | 1.02 | ![]() |
1.42 | ![]() | |||
Kcnb2 | MY | Medulla | 1.55 | ![]() |
2.07 | ![]() | |||
Kcnb2 | OLF | Olfactory bulb | 23.65 | ![]() |
29.4 | ![]() | |||
Kcnb2 | P | Pons | 1.39 | ![]() |
1.99 | ![]() | |||
Kcnb2 | PAL | Pallidum | 1.92 | ![]() |
2.44 | ![]() | |||
Kcnb2 | RHP | Retrohippocampal region | 3.04 | ![]() |
2.5 | ![]() | |||
Kcnb2 | sAMY | Striatum-like amygdalar nuclei | 1 | ![]() |
1.42 | ![]() | |||
Kcnb2 | STR | Striatum | 0.6 | ![]() |
0.72 | ![]() | |||
Kcnb2 | STRd | Striatum dorsal region | 0.35 | ![]() |
0.51 | ![]() | |||
Kcnb2 | STRv | Striatum ventral region | 1.2 | ![]() |
0.9 | ![]() | |||
Kcnb2 | TH | Thalamus | 0.86 | ![]() |
0.87 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
KCNB2_HUMAN_876 | 31 | 876 | 906 | DSSQEGCKMENHLFAPEIHSNPGDTGYCPTR | PRIDE |