Annotation Detail for TM9SF2


Gene Symbol: | TM9SF2 ( FLJ26287,MGC117391,P76 ) |
---|---|
Gene Full Name: | transmembrane 9 superfamily member 2 |
Band: | 13q32.3 |
Quick Links | Entrez ID:9375; OMIM: 604678; Uniprot ID:TM9S2_HUMAN; ENSEMBL ID: ENSG00000125304; HGNC ID: 11865 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.654824
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 15 / 70761 | 211 | ![]() |
blastocyst | 2 / 62319 | 32 | ![]() |
fetus | 66 / 564012 | 117 | ![]() |
neonate | 11 / 31097 | 353 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 13 / 55556 | 233 | ![]() |
adult | 293 / 1939121 | 151 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 14 / 12794 | 1094 | ![]() |
bladder carcinoma | 6 / 17475 | 343 | ![]() |
breast (mammary gland) tumor | 30 / 94178 | 318 | ![]() |
cervical tumor | 5 / 34366 | 145 | ![]() |
chondrosarcoma | 5 / 82823 | 60 | ![]() |
colorectal tumor | 16 / 114246 | 140 | ![]() |
esophageal tumor | 10 / 17290 | 578 | ![]() |
gastrointestinal tumor | 14 / 119369 | 117 | ![]() |
germ cell tumor | 26 / 263845 | 98 | ![]() |
glioma | 14 / 106883 | 130 | ![]() |
head and neck tumor | 58 / 136302 | 425 | ![]() |
kidney tumor | 11 / 68959 | 159 | ![]() |
leukemia | 15 / 95842 | 156 | ![]() |
liver tumor | 33 / 96359 | 342 | ![]() |
lung tumor | 5 / 103127 | 48 | ![]() |
lymphoma | 3 / 71755 | 41 | ![]() |
non-neoplasia | 14 / 97250 | 143 | ![]() |
normal | 510 / 3360307 | 151 | ![]() |
ovarian tumor | 8 / 76682 | 104 | ![]() |
pancreatic tumor | 7 / 104616 | 66 | ![]() |
primitive neuroectodermal tumor of the CNS | 14 / 125680 | 111 | ![]() |
prostate cancer | 19 / 102680 | 185 | ![]() |
retinoblastoma | 3 / 46356 | 64 | ![]() |
skin tumor | 12 / 124949 | 96 | ![]() |
soft tissue/muscle tissue tumor | 9 / 125191 | 71 | ![]() |
uterine tumor | 20 / 90257 | 221 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 2 / 13106 | 152 | ![]() |
adrenal gland | 16 / 33197 | 481 | ![]() |
ascites | 2 / 40015 | 49 | ![]() |
bladder | 15 / 29757 | 504 | ![]() |
blood | 24 / 123478 | 194 | ![]() |
bone | 10 / 71655 | 139 | ![]() |
bone marrow | 13 / 48801 | 266 | ![]() |
brain | 183 / 1100989 | 166 | ![]() |
cervix | 5 / 48171 | 103 | ![]() |
connective tissue | 16 / 149255 | 107 | ![]() |
ear | 4 / 16212 | 246 | ![]() |
embryonic tissue | 25 / 215722 | 115 | ![]() |
esophagus | 10 / 20209 | 494 | ![]() |
eye | 13 / 211054 | 61 | ![]() |
heart | 7 / 89626 | 78 | ![]() |
intestine | 40 / 234472 | 170 | ![]() |
kidney | 29 / 211777 | 136 | ![]() |
larynx | 2 / 24145 | 82 | ![]() |
liver | 55 / 207743 | 264 | ![]() |
lung | 39 / 336974 | 115 | ![]() |
lymph | 2 / 44270 | 45 | ![]() |
lymph node | 9 / 91610 | 98 | ![]() |
mammary gland | 35 / 153271 | 228 | ![]() |
mouth | 21 / 67052 | 313 | ![]() |
muscle | 20 / 107715 | 185 | ![]() |
nerve | 1 / 15768 | 63 | ![]() |
ovary | 10 / 102051 | 97 | ![]() |
pancreas | 16 / 214812 | 74 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 35 / 41328 | 846 | ![]() |
pituitary gland | 4 / 16585 | 241 | ![]() |
placenta | 46 / 280825 | 163 | ![]() |
prostate | 31 / 189345 | 163 | ![]() |
salivary gland | 1 / 20155 | 49 | ![]() |
skin | 24 / 210574 | 113 | ![]() |
spleen | 7 / 53952 | 129 | ![]() |
stomach | 16 / 96619 | 165 | ![]() |
testis | 77 / 330442 | 233 | ![]() |
thymus | 25 / 81131 | 308 | ![]() |
thyroid | 6 / 47473 | 126 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 14 / 52413 | 267 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 33 / 232878 | 141 | ![]() |
vascular | 21 / 51780 | 405 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201078_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 437.95 | ![]() |
Adipocyte | 309.35 | ![]() |
AdrenalCortex | 35.75 | ![]() |
Adrenalgland | 136.8 | ![]() |
Amygdala | 293.1 | ![]() |
Appendix | 47.95 | ![]() |
AtrioventricularNode | 75.95 | ![]() |
BDCA4+_DentriticCells | 1158.1 | ![]() |
Bonemarrow | 222.3 | ![]() |
BronchialEpithelialCells | 436.9 | ![]() |
CD105+_Endothelial | 117.6 | ![]() |
CD14+_Monocytes | 591.5 | ![]() |
CD19+_BCells(neg._sel.) | 168.5 | ![]() |
CD33+_Myeloid | 712.55 | ![]() |
CD34+ | 310.75 | ![]() |
CD4+_Tcells | 187.95 | ![]() |
CD56+_NKCells | 284.5 | ![]() |
CD71+_EarlyErythroid | 143.95 | ![]() |
CD8+_Tcells | 239.55 | ![]() |
CardiacMyocytes | 226.7 | ![]() |
Caudatenucleus | 110.25 | ![]() |
Cerebellum | 73.15 | ![]() |
CerebellumPeduncles | 103.25 | ![]() |
CiliaryGanglion | 53.15 | ![]() |
CingulateCortex | 103.95 | ![]() |
Colorectaladenocarcinoma | 372.8 | ![]() |
DorsalRootGanglion | 85.05 | ![]() |
FetalThyroid | 168.5 | ![]() |
Fetalbrain | 132.4 | ![]() |
Fetalliver | 318.55 | ![]() |
Fetallung | 259.3 | ![]() |
GlobusPallidus | 53.85 | ![]() |
Heart | 29.8 | ![]() |
Hypothalamus | 259.35 | ![]() |
Kidney | 159.95 | ![]() |
Leukemia_chronicMyelogenousK-562 | 159.2 | ![]() |
Leukemia_promyelocytic-HL-60 | 54.4 | ![]() |
Leukemialymphoblastic(MOLT-4) | 98.5 | ![]() |
Liver | 111.8 | ![]() |
Lung | 136.8 | ![]() |
Lymphnode | 206.55 | ![]() |
Lymphoma_burkitts(Daudi) | 152.45 | ![]() |
Lymphoma_burkitts(Raji) | 24.25 | ![]() |
MedullaOblongata | 79.15 | ![]() |
OccipitalLobe | 134.3 | ![]() |
OlfactoryBulb | 132.2 | ![]() |
Ovary | 55.8 | ![]() |
Pancreas | 682.2 | ![]() |
PancreaticIslet | 324.7 | ![]() |
ParietalLobe | 95.8 | ![]() |
Pituitary | 294.2 | ![]() |
Placenta | 1183.35 | ![]() |
Pons | 37.05 | ![]() |
PrefrontalCortex | 149.1 | ![]() |
Prostate | 472.45 | ![]() |
Salivarygland | 289.4 | ![]() |
SkeletalMuscle | 16.5 | ![]() |
Skin | 46.05 | ![]() |
SmoothMuscle | 310.8 | ![]() |
Spinalcord | 145.3 | ![]() |
SubthalamicNucleus | 72.15 | ![]() |
SuperiorCervicalGanglion | 32.45 | ![]() |
TemporalLobe | 33.35 | ![]() |
Testis | 249.75 | ![]() |
TestisGermCell | 289.6 | ![]() |
TestisIntersitial | 343.5 | ![]() |
TestisLeydigCell | 239 | ![]() |
TestisSeminiferousTubule | 150.5 | ![]() |
Thalamus | 153.75 | ![]() |
Thymus | 102.2 | ![]() |
Thyroid | 624.4 | ![]() |
Tongue | 46.8 | ![]() |
Tonsil | 168.45 | ![]() |
Trachea | 388 | ![]() |
TrigeminalGanglion | 72.05 | ![]() |
Uterus | 210.7 | ![]() |
UterusCorpus | 75.3 | ![]() |
WholeBlood | 643.3 | ![]() |
Wholebrain | 227.05 | ![]() |
colon | 684.15 | ![]() |
pineal_day | 312.88 | ![]() |
pineal_night | 308.24 | ![]() |
retina | 446.55 | ![]() |
small_intestine | 892.5 | ![]() |
- Probe name: A_24_P210399
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 6.04 ± 0.76 | ![]() ![]() ![]() |
Basal Forebrain | 6.39 ± 0.4 | ![]() ![]() ![]() |
Basal Part of Pons | 7.06 ± 0.53 | ![]() ![]() ![]() |
Cerebellar Cortex | 7.03 ± 0.22 | ![]() ![]() ![]() |
Cerebellar Nuclei | 6.7 ± 0.61 | ![]() ![]() ![]() |
Claustrum | 6.06 ± 0.68 | ![]() ![]() ![]() |
Epithalamus | 7.21 ± 0.4 | ![]() ![]() ![]() |
Frontal Lobe | 6.81 ± 0.43 | ![]() ![]() ![]() |
Globus Pallidus | 5.55 ± 0.39 | ![]() ![]() ![]() |
Hypothalamus | 7.02 ± 0.45 | ![]() ![]() ![]() |
Insula | 6.74 ± 0.42 | ![]() ![]() ![]() |
Limbic Lobe | 6.21 ± 0.77 | ![]() ![]() ![]() |
Mesencephalon | 6.41 ± 0.51 | ![]() ![]() ![]() |
Myelencephalon | 6.49 ± 0.68 | ![]() ![]() ![]() |
Occipital Lobe | 6.03 ± 0.68 | ![]() ![]() ![]() |
Parietal Lobe | 6.53 ± 0.64 | ![]() ![]() ![]() |
Pontine Tegmentum | 6.47 ± 0.61 | ![]() ![]() ![]() |
Striatum | 5.74 ± 0.62 | ![]() ![]() ![]() |
Subthalamus | 6.52 ± 1.21 | ![]() ![]() ![]() |
Temporal Lobe | 6.69 ± 0.5 | ![]() ![]() ![]() |
Thalamus | 6.49 ± 0.52 | ![]() ![]() ![]() |
White Matter | 6.05 ± 0.61 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Tm9sf2 | CB | Cerebellum | 29.9 | ![]() |
91.77 | ![]() | |||
Tm9sf2 | CTX | Cerebral cortex | 100 | ![]() |
100 | ![]() | |||
Tm9sf2 | HIP | Hippocampal region | 100 | ![]() |
100 | ![]() | |||
Tm9sf2 | HPF | Hippocampal formation | 100 | ![]() |
100 | ![]() | |||
Tm9sf2 | HY | Hypothalamus | 52.81 | ![]() |
56.12 | ![]() | |||
Tm9sf2 | LSX | Lateral septal complex | 46.73 | ![]() |
42.39 | ![]() | |||
Tm9sf2 | MB | Midbrain | 58.23 | ![]() |
65.69 | ![]() | |||
Tm9sf2 | MY | Medulla | 78.1 | ![]() |
100 | ![]() | |||
Tm9sf2 | OLF | Olfactory bulb | 86.71 | ![]() |
100 | ![]() | |||
Tm9sf2 | P | Pons | 56.62 | ![]() |
74.2 | ![]() | |||
Tm9sf2 | PAL | Pallidum | 71.67 | ![]() |
85.45 | ![]() | |||
Tm9sf2 | RHP | Retrohippocampal region | 100 | ![]() |
100 | ![]() | |||
Tm9sf2 | sAMY | Striatum-like amygdalar nuclei | 100 | ![]() |
100 | ![]() | |||
Tm9sf2 | STR | Striatum | 85.7 | ![]() |
82.1 | ![]() | |||
Tm9sf2 | STRd | Striatum dorsal region | 81.68 | ![]() |
75.43 | ![]() | |||
Tm9sf2 | STRv | Striatum ventral region | 98.08 | ![]() |
90.51 | ![]() | |||
Tm9sf2 | TH | Thalamus | 66.42 | ![]() |
70.8 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00000293 | 33 | 58 | 90 | AEIELFVNRLDSVESVLPYEYTAFDFCQASEGK | Peptide Atlas |
TM9S2_HUMAN_92 | 13 | 92 | 104 | PSENLGQVLFGER | PRIDE |