Annotation Detail for TM9SF2
Basic Information Top
| Gene Symbol: | TM9SF2 ( FLJ26287,MGC117391,P76 ) |
|---|---|
| Gene Full Name: | transmembrane 9 superfamily member 2 |
| Band: | 13q32.3 |
| Quick Links | Entrez ID:9375; OMIM: 604678; Uniprot ID:TM9S2_HUMAN; ENSEMBL ID: ENSG00000125304; HGNC ID: 11865 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.654824
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 15 / 70761 | 211 | |
| blastocyst | 2 / 62319 | 32 | |
| fetus | 66 / 564012 | 117 | |
| neonate | 11 / 31097 | 353 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 13 / 55556 | 233 | |
| adult | 293 / 1939121 | 151 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 14 / 12794 | 1094 | |
| bladder carcinoma | 6 / 17475 | 343 | |
| breast (mammary gland) tumor | 30 / 94178 | 318 | |
| cervical tumor | 5 / 34366 | 145 | |
| chondrosarcoma | 5 / 82823 | 60 | |
| colorectal tumor | 16 / 114246 | 140 | |
| esophageal tumor | 10 / 17290 | 578 | |
| gastrointestinal tumor | 14 / 119369 | 117 | |
| germ cell tumor | 26 / 263845 | 98 | |
| glioma | 14 / 106883 | 130 | |
| head and neck tumor | 58 / 136302 | 425 | |
| kidney tumor | 11 / 68959 | 159 | |
| leukemia | 15 / 95842 | 156 | |
| liver tumor | 33 / 96359 | 342 | |
| lung tumor | 5 / 103127 | 48 | |
| lymphoma | 3 / 71755 | 41 | |
| non-neoplasia | 14 / 97250 | 143 | |
| normal | 510 / 3360307 | 151 | |
| ovarian tumor | 8 / 76682 | 104 | |
| pancreatic tumor | 7 / 104616 | 66 | |
| primitive neuroectodermal tumor of the CNS | 14 / 125680 | 111 | |
| prostate cancer | 19 / 102680 | 185 | |
| retinoblastoma | 3 / 46356 | 64 | |
| skin tumor | 12 / 124949 | 96 | |
| soft tissue/muscle tissue tumor | 9 / 125191 | 71 | |
| uterine tumor | 20 / 90257 | 221 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 2 / 13106 | 152 | |
| adrenal gland | 16 / 33197 | 481 | |
| ascites | 2 / 40015 | 49 | |
| bladder | 15 / 29757 | 504 | |
| blood | 24 / 123478 | 194 | |
| bone | 10 / 71655 | 139 | |
| bone marrow | 13 / 48801 | 266 | |
| brain | 183 / 1100989 | 166 | |
| cervix | 5 / 48171 | 103 | |
| connective tissue | 16 / 149255 | 107 | |
| ear | 4 / 16212 | 246 | |
| embryonic tissue | 25 / 215722 | 115 | |
| esophagus | 10 / 20209 | 494 | |
| eye | 13 / 211054 | 61 | |
| heart | 7 / 89626 | 78 | |
| intestine | 40 / 234472 | 170 | |
| kidney | 29 / 211777 | 136 | |
| larynx | 2 / 24145 | 82 | |
| liver | 55 / 207743 | 264 | |
| lung | 39 / 336974 | 115 | |
| lymph | 2 / 44270 | 45 | |
| lymph node | 9 / 91610 | 98 | |
| mammary gland | 35 / 153271 | 228 | |
| mouth | 21 / 67052 | 313 | |
| muscle | 20 / 107715 | 185 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 10 / 102051 | 97 | |
| pancreas | 16 / 214812 | 74 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 35 / 41328 | 846 | |
| pituitary gland | 4 / 16585 | 241 | |
| placenta | 46 / 280825 | 163 | |
| prostate | 31 / 189345 | 163 | |
| salivary gland | 1 / 20155 | 49 | |
| skin | 24 / 210574 | 113 | |
| spleen | 7 / 53952 | 129 | |
| stomach | 16 / 96619 | 165 | |
| testis | 77 / 330442 | 233 | |
| thymus | 25 / 81131 | 308 | |
| thyroid | 6 / 47473 | 126 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 14 / 52413 | 267 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 33 / 232878 | 141 | |
| vascular | 21 / 51780 | 405 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201078_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 437.95 | |
| Adipocyte | 309.35 | |
| AdrenalCortex | 35.75 | |
| Adrenalgland | 136.8 | |
| Amygdala | 293.1 | |
| Appendix | 47.95 | |
| AtrioventricularNode | 75.95 | |
| BDCA4+_DentriticCells | 1158.1 | |
| Bonemarrow | 222.3 | |
| BronchialEpithelialCells | 436.9 | |
| CD105+_Endothelial | 117.6 | |
| CD14+_Monocytes | 591.5 | |
| CD19+_BCells(neg._sel.) | 168.5 | |
| CD33+_Myeloid | 712.55 | |
| CD34+ | 310.75 | |
| CD4+_Tcells | 187.95 | |
| CD56+_NKCells | 284.5 | |
| CD71+_EarlyErythroid | 143.95 | |
| CD8+_Tcells | 239.55 | |
| CardiacMyocytes | 226.7 | |
| Caudatenucleus | 110.25 | |
| Cerebellum | 73.15 | |
| CerebellumPeduncles | 103.25 | |
| CiliaryGanglion | 53.15 | |
| CingulateCortex | 103.95 | |
| Colorectaladenocarcinoma | 372.8 | |
| DorsalRootGanglion | 85.05 | |
| FetalThyroid | 168.5 | |
| Fetalbrain | 132.4 | |
| Fetalliver | 318.55 | |
| Fetallung | 259.3 | |
| GlobusPallidus | 53.85 | |
| Heart | 29.8 | |
| Hypothalamus | 259.35 | |
| Kidney | 159.95 | |
| Leukemia_chronicMyelogenousK-562 | 159.2 | |
| Leukemia_promyelocytic-HL-60 | 54.4 | |
| Leukemialymphoblastic(MOLT-4) | 98.5 | |
| Liver | 111.8 | |
| Lung | 136.8 | |
| Lymphnode | 206.55 | |
| Lymphoma_burkitts(Daudi) | 152.45 | |
| Lymphoma_burkitts(Raji) | 24.25 | |
| MedullaOblongata | 79.15 | |
| OccipitalLobe | 134.3 | |
| OlfactoryBulb | 132.2 | |
| Ovary | 55.8 | |
| Pancreas | 682.2 | |
| PancreaticIslet | 324.7 | |
| ParietalLobe | 95.8 | |
| Pituitary | 294.2 | |
| Placenta | 1183.35 | |
| Pons | 37.05 | |
| PrefrontalCortex | 149.1 | |
| Prostate | 472.45 | |
| Salivarygland | 289.4 | |
| SkeletalMuscle | 16.5 | |
| Skin | 46.05 | |
| SmoothMuscle | 310.8 | |
| Spinalcord | 145.3 | |
| SubthalamicNucleus | 72.15 | |
| SuperiorCervicalGanglion | 32.45 | |
| TemporalLobe | 33.35 | |
| Testis | 249.75 | |
| TestisGermCell | 289.6 | |
| TestisIntersitial | 343.5 | |
| TestisLeydigCell | 239 | |
| TestisSeminiferousTubule | 150.5 | |
| Thalamus | 153.75 | |
| Thymus | 102.2 | |
| Thyroid | 624.4 | |
| Tongue | 46.8 | |
| Tonsil | 168.45 | |
| Trachea | 388 | |
| TrigeminalGanglion | 72.05 | |
| Uterus | 210.7 | |
| UterusCorpus | 75.3 | |
| WholeBlood | 643.3 | |
| Wholebrain | 227.05 | |
| colon | 684.15 | |
| pineal_day | 312.88 | |
| pineal_night | 308.24 | |
| retina | 446.55 | |
| small_intestine | 892.5 |
- Probe name: A_24_P210399
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 6.04 ± 0.76 | |
| Basal Forebrain | 6.39 ± 0.4 | |
| Basal Part of Pons | 7.06 ± 0.53 | |
| Cerebellar Cortex | 7.03 ± 0.22 | |
| Cerebellar Nuclei | 6.7 ± 0.61 | |
| Claustrum | 6.06 ± 0.68 | |
| Epithalamus | 7.21 ± 0.4 | |
| Frontal Lobe | 6.81 ± 0.43 | |
| Globus Pallidus | 5.55 ± 0.39 | |
| Hypothalamus | 7.02 ± 0.45 | |
| Insula | 6.74 ± 0.42 | |
| Limbic Lobe | 6.21 ± 0.77 | |
| Mesencephalon | 6.41 ± 0.51 | |
| Myelencephalon | 6.49 ± 0.68 | |
| Occipital Lobe | 6.03 ± 0.68 | |
| Parietal Lobe | 6.53 ± 0.64 | |
| Pontine Tegmentum | 6.47 ± 0.61 | |
| Striatum | 5.74 ± 0.62 | |
| Subthalamus | 6.52 ± 1.21 | |
| Temporal Lobe | 6.69 ± 0.5 | |
| Thalamus | 6.49 ± 0.52 | |
| White Matter | 6.05 ± 0.61 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Tm9sf2 | CB | Cerebellum | 29.9 | |
| 91.77 | ||||
| Tm9sf2 | CTX | Cerebral cortex | 100 | |
| 100 | ||||
| Tm9sf2 | HIP | Hippocampal region | 100 | |
| 100 | ||||
| Tm9sf2 | HPF | Hippocampal formation | 100 | |
| 100 | ||||
| Tm9sf2 | HY | Hypothalamus | 52.81 | |
| 56.12 | ||||
| Tm9sf2 | LSX | Lateral septal complex | 46.73 | |
| 42.39 | ||||
| Tm9sf2 | MB | Midbrain | 58.23 | |
| 65.69 | ||||
| Tm9sf2 | MY | Medulla | 78.1 | |
| 100 | ||||
| Tm9sf2 | OLF | Olfactory bulb | 86.71 | |
| 100 | ||||
| Tm9sf2 | P | Pons | 56.62 | |
| 74.2 | ||||
| Tm9sf2 | PAL | Pallidum | 71.67 | |
| 85.45 | ||||
| Tm9sf2 | RHP | Retrohippocampal region | 100 | |
| 100 | ||||
| Tm9sf2 | sAMY | Striatum-like amygdalar nuclei | 100 | |
| 100 | ||||
| Tm9sf2 | STR | Striatum | 85.7 | |
| 82.1 | ||||
| Tm9sf2 | STRd | Striatum dorsal region | 81.68 | |
| 75.43 | ||||
| Tm9sf2 | STRv | Striatum ventral region | 98.08 | |
| 90.51 | ||||
| Tm9sf2 | TH | Thalamus | 66.42 | |
| 70.8 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00000293 | 33 | 58 | 90 | AEIELFVNRLDSVESVLPYEYTAFDFCQASEGK | Peptide Atlas |
| TM9S2_HUMAN_92 | 13 | 92 | 104 | PSENLGQVLFGER | PRIDE |



