Annotation Detail for SCARB2
Basic Information Top
| Gene Symbol: | SCARB2 ( AMRF,CD36L2,HLGP85,LIMPII,SR-BII ) |
|---|---|
| Gene Full Name: | scavenger receptor class B, member 2 |
| Band: | 4q21.1 |
| Quick Links | Entrez ID:950; OMIM: 602257; Uniprot ID:SCRB2_HUMAN; ENSEMBL ID: ENSG00000138760; HGNC ID: 1665 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.349656
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 9 / 70761 | 127 | |
| blastocyst | 4 / 62319 | 64 | |
| fetus | 90 / 564012 | 159 | |
| neonate | 4 / 31097 | 128 | |
| infant | 0 / 23620 | 0 | |
| juvenile | 9 / 55556 | 161 | |
| adult | 260 / 1939121 | 134 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 3 / 12794 | 234 | |
| bladder carcinoma | 2 / 17475 | 114 | |
| breast (mammary gland) tumor | 9 / 94178 | 95 | |
| cervical tumor | 0 / 34366 | 0 | |
| chondrosarcoma | 22 / 82823 | 265 | |
| colorectal tumor | 10 / 114246 | 87 | |
| esophageal tumor | 6 / 17290 | 347 | |
| gastrointestinal tumor | 17 / 119369 | 142 | |
| germ cell tumor | 27 / 263845 | 102 | |
| glioma | 22 / 106883 | 205 | |
| head and neck tumor | 5 / 136302 | 36 | |
| kidney tumor | 7 / 68959 | 101 | |
| leukemia | 2 / 95842 | 20 | |
| liver tumor | 6 / 96359 | 62 | |
| lung tumor | 4 / 103127 | 38 | |
| lymphoma | 1 / 71755 | 13 | |
| non-neoplasia | 17 / 97250 | 174 | |
| normal | 456 / 3360307 | 135 | |
| ovarian tumor | 5 / 76682 | 65 | |
| pancreatic tumor | 20 / 104616 | 191 | |
| primitive neuroectodermal tumor of the CNS | 13 / 125680 | 103 | |
| prostate cancer | 10 / 102680 | 97 | |
| retinoblastoma | 12 / 46356 | 258 | |
| skin tumor | 13 / 124949 | 104 | |
| soft tissue/muscle tissue tumor | 12 / 125191 | 95 | |
| uterine tumor | 6 / 90257 | 66 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 3 / 13106 | 228 | |
| adrenal gland | 7 / 33197 | 210 | |
| ascites | 6 / 40015 | 149 | |
| bladder | 1 / 29757 | 33 | |
| blood | 7 / 123478 | 56 | |
| bone | 12 / 71655 | 167 | |
| bone marrow | 1 / 48801 | 20 | |
| brain | 148 / 1100989 | 134 | |
| cervix | 0 / 48171 | 0 | |
| connective tissue | 32 / 149255 | 214 | |
| ear | 1 / 16212 | 61 | |
| embryonic tissue | 18 / 215722 | 83 | |
| esophagus | 6 / 20209 | 296 | |
| eye | 46 / 211054 | 217 | |
| heart | 14 / 89626 | 156 | |
| intestine | 20 / 234472 | 85 | |
| kidney | 27 / 211777 | 127 | |
| larynx | 1 / 24145 | 41 | |
| liver | 13 / 207743 | 62 | |
| lung | 54 / 336974 | 160 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 6 / 91610 | 65 | |
| mammary gland | 16 / 153271 | 104 | |
| mouth | 4 / 67052 | 59 | |
| muscle | 3 / 107715 | 27 | |
| nerve | 6 / 15768 | 380 | |
| ovary | 9 / 102051 | 88 | |
| pancreas | 45 / 214812 | 209 | |
| parathyroid | 1 / 20539 | 48 | |
| pharynx | 4 / 41328 | 96 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 59 / 280825 | 210 | |
| prostate | 16 / 189345 | 84 | |
| salivary gland | 1 / 20155 | 49 | |
| skin | 18 / 210574 | 85 | |
| spleen | 6 / 53952 | 111 | |
| stomach | 10 / 96619 | 103 | |
| testis | 34 / 330442 | 102 | |
| thymus | 6 / 81131 | 73 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 17 / 52413 | 324 | |
| umbilical cord | 3 / 13680 | 219 | |
| uterus | 25 / 232878 | 107 | |
| vascular | 7 / 51780 | 135 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201647_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 6.9 | |
| Adipocyte | 53.8 | |
| AdrenalCortex | 6.85 | |
| Adrenalgland | 5 | |
| Amygdala | 19.75 | |
| Appendix | 10.55 | |
| AtrioventricularNode | 5.9 | |
| BDCA4+_DentriticCells | 130.95 | |
| Bonemarrow | 6.3 | |
| BronchialEpithelialCells | 7.25 | |
| CD105+_Endothelial | 6.1 | |
| CD14+_Monocytes | 9.65 | |
| CD19+_BCells(neg._sel.) | 6.3 | |
| CD33+_Myeloid | 16.95 | |
| CD34+ | 7.2 | |
| CD4+_Tcells | 6.2 | |
| CD56+_NKCells | 7.05 | |
| CD71+_EarlyErythroid | 5.9 | |
| CD8+_Tcells | 5.6 | |
| CardiacMyocytes | 9.7 | |
| Caudatenucleus | 5.9 | |
| Cerebellum | 5.05 | |
| CerebellumPeduncles | 8.15 | |
| CiliaryGanglion | 5.8 | |
| CingulateCortex | 6.9 | |
| Colorectaladenocarcinoma | 6.25 | |
| DorsalRootGanglion | 5.55 | |
| FetalThyroid | 6.1 | |
| Fetalbrain | 5.95 | |
| Fetalliver | 6.4 | |
| Fetallung | 13.25 | |
| GlobusPallidus | 4.85 | |
| Heart | 7.75 | |
| Hypothalamus | 11.6 | |
| Kidney | 5.2 | |
| Leukemia_chronicMyelogenousK-562 | 5.1 | |
| Leukemia_promyelocytic-HL-60 | 5.05 | |
| Leukemialymphoblastic(MOLT-4) | 4.4 | |
| Liver | 7.7 | |
| Lung | 6.7 | |
| Lymphnode | 5.35 | |
| Lymphoma_burkitts(Daudi) | 7.35 | |
| Lymphoma_burkitts(Raji) | 8.15 | |
| MedullaOblongata | 8.25 | |
| OccipitalLobe | 9.05 | |
| OlfactoryBulb | 5.35 | |
| Ovary | 4.7 | |
| Pancreas | 5.2 | |
| PancreaticIslet | 48.85 | |
| ParietalLobe | 9.45 | |
| Pituitary | 6.7 | |
| Placenta | 40.25 | |
| Pons | 5.8 | |
| PrefrontalCortex | 9.05 | |
| Prostate | 8 | |
| Salivarygland | 5.05 | |
| SkeletalMuscle | 8.6 | |
| Skin | 5.65 | |
| SmoothMuscle | 12.5 | |
| Spinalcord | 6.3 | |
| SubthalamicNucleus | 5.85 | |
| SuperiorCervicalGanglion | 8.1 | |
| TemporalLobe | 5.45 | |
| Testis | 5.25 | |
| TestisGermCell | 6 | |
| TestisIntersitial | 5.05 | |
| TestisLeydigCell | 5.95 | |
| TestisSeminiferousTubule | 5.2 | |
| Thalamus | 6.1 | |
| Thymus | 4.45 | |
| Thyroid | 11.85 | |
| Tongue | 6.5 | |
| Tonsil | 5.7 | |
| Trachea | 9.55 | |
| TrigeminalGanglion | 10.35 | |
| Uterus | 9.7 | |
| UterusCorpus | 5.7 | |
| WholeBlood | 6.25 | |
| Wholebrain | 5.1 | |
| colon | 44.85 | |
| pineal_day | 112.42 | |
| pineal_night | 139.82 | |
| retina | 11.75 | |
| small_intestine | 17.1 |
- Probe name: A_24_P54879
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 7.24 ± 0.51 | |
| Basal Forebrain | 7.76 ± 0.36 | |
| Basal Part of Pons | 7.81 ± 0.41 | |
| Cerebellar Cortex | 7.38 ± 0.22 | |
| Cerebellar Nuclei | 8.38 ± 0.34 | |
| Claustrum | 7.04 ± 0.55 | |
| Epithalamus | 7.77 ± 0.48 | |
| Frontal Lobe | 7.77 ± 0.45 | |
| Globus Pallidus | 8.62 ± 0.28 | |
| Hypothalamus | 7.96 ± 0.19 | |
| Insula | 7.65 ± 0.29 | |
| Limbic Lobe | 7.33 ± 0.48 | |
| Mesencephalon | 7.74 ± 0.46 | |
| Myelencephalon | 7.69 ± 0.42 | |
| Occipital Lobe | 7.37 ± 0.41 | |
| Parietal Lobe | 7.66 ± 0.45 | |
| Pontine Tegmentum | 7.78 ± 0.29 | |
| Striatum | 7.71 ± 0.38 | |
| Subthalamus | 8.11 ± 0.36 | |
| Temporal Lobe | 7.57 ± 0.37 | |
| Thalamus | 7.86 ± 0.33 | |
| White Matter | 9.73 ± 0.26 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Scarb2 | CB | Cerebellum | 48.14 | |
| 73.33 | ||||
| Scarb2 | CTX | Cerebral cortex | 100 | |
| 100 | ||||
| Scarb2 | HIP | Hippocampal region | 63.18 | |
| 93.7 | ||||
| Scarb2 | HPF | Hippocampal formation | 78.35 | |
| 96.48 | ||||
| Scarb2 | HY | Hypothalamus | 100 | |
| 100 | ||||
| Scarb2 | LSX | Lateral septal complex | 92.96 | |
| 88.81 | ||||
| Scarb2 | MB | Midbrain | 90.92 | |
| 94.43 | ||||
| Scarb2 | MY | Medulla | 87.41 | |
| 100 | ||||
| Scarb2 | OLF | Olfactory bulb | 94.57 | |
| 97.89 | ||||
| Scarb2 | P | Pons | 90.83 | |
| 100 | ||||
| Scarb2 | PAL | Pallidum | 100 | |
| 100 | ||||
| Scarb2 | RHP | Retrohippocampal region | 100 | |
| 100 | ||||
| Scarb2 | sAMY | Striatum-like amygdalar nuclei | 100 | |
| 98.35 | ||||
| Scarb2 | STR | Striatum | 64.45 | |
| 60.21 | ||||
| Scarb2 | STRd | Striatum dorsal region | 50.8 | |
| 48.01 | ||||
| Scarb2 | STRv | Striatum ventral region | 65.7 | |
| 56.6 | ||||
| Scarb2 | TH | Thalamus | 96.11 | |
| 96.68 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00001234 | 18 | 245 | 262 | CNMINGTDGDSFHPLITK | Peptide Atlas |
| SCRB2_HUMAN_115 | 14 | 115 | 128 | AYVFERDQSVGDPK | PRIDE |
| SCRB2_HUMAN_115 | 19 | 115 | 133 | AYVFERDQSVGDPKIDLIR | PRIDE |
| SCRB2_HUMAN_127 | 7 | 127 | 133 | PKIDLIR | PRIDE |
| SCRB2_HUMAN_330 | 18 | 330 | 347 | NGAPIIMSFPHFYQADER | PRIDE |
| SCRB2_HUMAN_348 | 30 | 348 | 377 | FVSAIEGMHPNQEDHETFVDINPLTGIILK | PRIDE |
| SCRB2_HUMAN_390 | 12 | 390 | 401 | KLDDFVETGDIR | PRIDE |
| SCRB2_HUMAN_77 | 15 | 77 | 91 | GETPRVEEVGPYTYR | PRIDE |



