Annotation Detail for SCARB2


Gene Symbol: | SCARB2 ( AMRF,CD36L2,HLGP85,LIMPII,SR-BII ) |
---|---|
Gene Full Name: | scavenger receptor class B, member 2 |
Band: | 4q21.1 |
Quick Links | Entrez ID:950; OMIM: 602257; Uniprot ID:SCRB2_HUMAN; ENSEMBL ID: ENSG00000138760; HGNC ID: 1665 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.349656
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 9 / 70761 | 127 | ![]() |
blastocyst | 4 / 62319 | 64 | ![]() |
fetus | 90 / 564012 | 159 | ![]() |
neonate | 4 / 31097 | 128 | ![]() |
infant | 0 / 23620 | 0 | |
juvenile | 9 / 55556 | 161 | ![]() |
adult | 260 / 1939121 | 134 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 3 / 12794 | 234 | ![]() |
bladder carcinoma | 2 / 17475 | 114 | ![]() |
breast (mammary gland) tumor | 9 / 94178 | 95 | ![]() |
cervical tumor | 0 / 34366 | 0 | |
chondrosarcoma | 22 / 82823 | 265 | ![]() |
colorectal tumor | 10 / 114246 | 87 | ![]() |
esophageal tumor | 6 / 17290 | 347 | ![]() |
gastrointestinal tumor | 17 / 119369 | 142 | ![]() |
germ cell tumor | 27 / 263845 | 102 | ![]() |
glioma | 22 / 106883 | 205 | ![]() |
head and neck tumor | 5 / 136302 | 36 | ![]() |
kidney tumor | 7 / 68959 | 101 | ![]() |
leukemia | 2 / 95842 | 20 | ![]() |
liver tumor | 6 / 96359 | 62 | ![]() |
lung tumor | 4 / 103127 | 38 | ![]() |
lymphoma | 1 / 71755 | 13 | ![]() |
non-neoplasia | 17 / 97250 | 174 | ![]() |
normal | 456 / 3360307 | 135 | ![]() |
ovarian tumor | 5 / 76682 | 65 | ![]() |
pancreatic tumor | 20 / 104616 | 191 | ![]() |
primitive neuroectodermal tumor of the CNS | 13 / 125680 | 103 | ![]() |
prostate cancer | 10 / 102680 | 97 | ![]() |
retinoblastoma | 12 / 46356 | 258 | ![]() |
skin tumor | 13 / 124949 | 104 | ![]() |
soft tissue/muscle tissue tumor | 12 / 125191 | 95 | ![]() |
uterine tumor | 6 / 90257 | 66 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 3 / 13106 | 228 | ![]() |
adrenal gland | 7 / 33197 | 210 | ![]() |
ascites | 6 / 40015 | 149 | ![]() |
bladder | 1 / 29757 | 33 | ![]() |
blood | 7 / 123478 | 56 | ![]() |
bone | 12 / 71655 | 167 | ![]() |
bone marrow | 1 / 48801 | 20 | ![]() |
brain | 148 / 1100989 | 134 | ![]() |
cervix | 0 / 48171 | 0 | |
connective tissue | 32 / 149255 | 214 | ![]() |
ear | 1 / 16212 | 61 | ![]() |
embryonic tissue | 18 / 215722 | 83 | ![]() |
esophagus | 6 / 20209 | 296 | ![]() |
eye | 46 / 211054 | 217 | ![]() |
heart | 14 / 89626 | 156 | ![]() |
intestine | 20 / 234472 | 85 | ![]() |
kidney | 27 / 211777 | 127 | ![]() |
larynx | 1 / 24145 | 41 | ![]() |
liver | 13 / 207743 | 62 | ![]() |
lung | 54 / 336974 | 160 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 6 / 91610 | 65 | ![]() |
mammary gland | 16 / 153271 | 104 | ![]() |
mouth | 4 / 67052 | 59 | ![]() |
muscle | 3 / 107715 | 27 | ![]() |
nerve | 6 / 15768 | 380 | ![]() |
ovary | 9 / 102051 | 88 | ![]() |
pancreas | 45 / 214812 | 209 | ![]() |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 4 / 41328 | 96 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 59 / 280825 | 210 | ![]() |
prostate | 16 / 189345 | 84 | ![]() |
salivary gland | 1 / 20155 | 49 | ![]() |
skin | 18 / 210574 | 85 | ![]() |
spleen | 6 / 53952 | 111 | ![]() |
stomach | 10 / 96619 | 103 | ![]() |
testis | 34 / 330442 | 102 | ![]() |
thymus | 6 / 81131 | 73 | ![]() |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 17 / 52413 | 324 | ![]() |
umbilical cord | 3 / 13680 | 219 | ![]() |
uterus | 25 / 232878 | 107 | ![]() |
vascular | 7 / 51780 | 135 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 201647_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 6.9 | ![]() |
Adipocyte | 53.8 | ![]() |
AdrenalCortex | 6.85 | ![]() |
Adrenalgland | 5 | ![]() |
Amygdala | 19.75 | ![]() |
Appendix | 10.55 | ![]() |
AtrioventricularNode | 5.9 | ![]() |
BDCA4+_DentriticCells | 130.95 | ![]() |
Bonemarrow | 6.3 | ![]() |
BronchialEpithelialCells | 7.25 | ![]() |
CD105+_Endothelial | 6.1 | ![]() |
CD14+_Monocytes | 9.65 | ![]() |
CD19+_BCells(neg._sel.) | 6.3 | ![]() |
CD33+_Myeloid | 16.95 | ![]() |
CD34+ | 7.2 | ![]() |
CD4+_Tcells | 6.2 | ![]() |
CD56+_NKCells | 7.05 | ![]() |
CD71+_EarlyErythroid | 5.9 | ![]() |
CD8+_Tcells | 5.6 | ![]() |
CardiacMyocytes | 9.7 | ![]() |
Caudatenucleus | 5.9 | ![]() |
Cerebellum | 5.05 | ![]() |
CerebellumPeduncles | 8.15 | ![]() |
CiliaryGanglion | 5.8 | ![]() |
CingulateCortex | 6.9 | ![]() |
Colorectaladenocarcinoma | 6.25 | ![]() |
DorsalRootGanglion | 5.55 | ![]() |
FetalThyroid | 6.1 | ![]() |
Fetalbrain | 5.95 | ![]() |
Fetalliver | 6.4 | ![]() |
Fetallung | 13.25 | ![]() |
GlobusPallidus | 4.85 | ![]() |
Heart | 7.75 | ![]() |
Hypothalamus | 11.6 | ![]() |
Kidney | 5.2 | ![]() |
Leukemia_chronicMyelogenousK-562 | 5.1 | ![]() |
Leukemia_promyelocytic-HL-60 | 5.05 | ![]() |
Leukemialymphoblastic(MOLT-4) | 4.4 | ![]() |
Liver | 7.7 | ![]() |
Lung | 6.7 | ![]() |
Lymphnode | 5.35 | ![]() |
Lymphoma_burkitts(Daudi) | 7.35 | ![]() |
Lymphoma_burkitts(Raji) | 8.15 | ![]() |
MedullaOblongata | 8.25 | ![]() |
OccipitalLobe | 9.05 | ![]() |
OlfactoryBulb | 5.35 | ![]() |
Ovary | 4.7 | ![]() |
Pancreas | 5.2 | ![]() |
PancreaticIslet | 48.85 | ![]() |
ParietalLobe | 9.45 | ![]() |
Pituitary | 6.7 | ![]() |
Placenta | 40.25 | ![]() |
Pons | 5.8 | ![]() |
PrefrontalCortex | 9.05 | ![]() |
Prostate | 8 | ![]() |
Salivarygland | 5.05 | ![]() |
SkeletalMuscle | 8.6 | ![]() |
Skin | 5.65 | ![]() |
SmoothMuscle | 12.5 | ![]() |
Spinalcord | 6.3 | ![]() |
SubthalamicNucleus | 5.85 | ![]() |
SuperiorCervicalGanglion | 8.1 | ![]() |
TemporalLobe | 5.45 | ![]() |
Testis | 5.25 | ![]() |
TestisGermCell | 6 | ![]() |
TestisIntersitial | 5.05 | ![]() |
TestisLeydigCell | 5.95 | ![]() |
TestisSeminiferousTubule | 5.2 | ![]() |
Thalamus | 6.1 | ![]() |
Thymus | 4.45 | ![]() |
Thyroid | 11.85 | ![]() |
Tongue | 6.5 | ![]() |
Tonsil | 5.7 | ![]() |
Trachea | 9.55 | ![]() |
TrigeminalGanglion | 10.35 | ![]() |
Uterus | 9.7 | ![]() |
UterusCorpus | 5.7 | ![]() |
WholeBlood | 6.25 | ![]() |
Wholebrain | 5.1 | ![]() |
colon | 44.85 | ![]() |
pineal_day | 112.42 | ![]() |
pineal_night | 139.82 | ![]() |
retina | 11.75 | ![]() |
small_intestine | 17.1 | ![]() |
- Probe name: A_24_P54879
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 7.24 ± 0.51 | ![]() ![]() ![]() |
Basal Forebrain | 7.76 ± 0.36 | ![]() ![]() ![]() |
Basal Part of Pons | 7.81 ± 0.41 | ![]() ![]() ![]() |
Cerebellar Cortex | 7.38 ± 0.22 | ![]() ![]() ![]() |
Cerebellar Nuclei | 8.38 ± 0.34 | ![]() ![]() ![]() |
Claustrum | 7.04 ± 0.55 | ![]() ![]() ![]() |
Epithalamus | 7.77 ± 0.48 | ![]() ![]() ![]() |
Frontal Lobe | 7.77 ± 0.45 | ![]() ![]() ![]() |
Globus Pallidus | 8.62 ± 0.28 | ![]() ![]() ![]() |
Hypothalamus | 7.96 ± 0.19 | ![]() ![]() ![]() |
Insula | 7.65 ± 0.29 | ![]() ![]() ![]() |
Limbic Lobe | 7.33 ± 0.48 | ![]() ![]() ![]() |
Mesencephalon | 7.74 ± 0.46 | ![]() ![]() ![]() |
Myelencephalon | 7.69 ± 0.42 | ![]() ![]() ![]() |
Occipital Lobe | 7.37 ± 0.41 | ![]() ![]() ![]() |
Parietal Lobe | 7.66 ± 0.45 | ![]() ![]() ![]() |
Pontine Tegmentum | 7.78 ± 0.29 | ![]() ![]() ![]() |
Striatum | 7.71 ± 0.38 | ![]() ![]() ![]() |
Subthalamus | 8.11 ± 0.36 | ![]() ![]() ![]() |
Temporal Lobe | 7.57 ± 0.37 | ![]() ![]() ![]() |
Thalamus | 7.86 ± 0.33 | ![]() ![]() ![]() |
White Matter | 9.73 ± 0.26 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Scarb2 | CB | Cerebellum | 48.14 | ![]() |
73.33 | ![]() | |||
Scarb2 | CTX | Cerebral cortex | 100 | ![]() |
100 | ![]() | |||
Scarb2 | HIP | Hippocampal region | 63.18 | ![]() |
93.7 | ![]() | |||
Scarb2 | HPF | Hippocampal formation | 78.35 | ![]() |
96.48 | ![]() | |||
Scarb2 | HY | Hypothalamus | 100 | ![]() |
100 | ![]() | |||
Scarb2 | LSX | Lateral septal complex | 92.96 | ![]() |
88.81 | ![]() | |||
Scarb2 | MB | Midbrain | 90.92 | ![]() |
94.43 | ![]() | |||
Scarb2 | MY | Medulla | 87.41 | ![]() |
100 | ![]() | |||
Scarb2 | OLF | Olfactory bulb | 94.57 | ![]() |
97.89 | ![]() | |||
Scarb2 | P | Pons | 90.83 | ![]() |
100 | ![]() | |||
Scarb2 | PAL | Pallidum | 100 | ![]() |
100 | ![]() | |||
Scarb2 | RHP | Retrohippocampal region | 100 | ![]() |
100 | ![]() | |||
Scarb2 | sAMY | Striatum-like amygdalar nuclei | 100 | ![]() |
98.35 | ![]() | |||
Scarb2 | STR | Striatum | 64.45 | ![]() |
60.21 | ![]() | |||
Scarb2 | STRd | Striatum dorsal region | 50.8 | ![]() |
48.01 | ![]() | |||
Scarb2 | STRv | Striatum ventral region | 65.7 | ![]() |
56.6 | ![]() | |||
Scarb2 | TH | Thalamus | 96.11 | ![]() |
96.68 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00001234 | 18 | 245 | 262 | CNMINGTDGDSFHPLITK | Peptide Atlas |
SCRB2_HUMAN_115 | 14 | 115 | 128 | AYVFERDQSVGDPK | PRIDE |
SCRB2_HUMAN_115 | 19 | 115 | 133 | AYVFERDQSVGDPKIDLIR | PRIDE |
SCRB2_HUMAN_127 | 7 | 127 | 133 | PKIDLIR | PRIDE |
SCRB2_HUMAN_330 | 18 | 330 | 347 | NGAPIIMSFPHFYQADER | PRIDE |
SCRB2_HUMAN_348 | 30 | 348 | 377 | FVSAIEGMHPNQEDHETFVDINPLTGIILK | PRIDE |
SCRB2_HUMAN_390 | 12 | 390 | 401 | KLDDFVETGDIR | PRIDE |
SCRB2_HUMAN_77 | 15 | 77 | 91 | GETPRVEEVGPYTYR | PRIDE |