Annotation Detail for BAG3


Gene Symbol: | BAG3 ( BAG-3,BIS,CAIR-1,MGC104307 ) |
---|---|
Gene Full Name: | BCL2-associated athanogene 3 |
Band: | 10q26.11 |
Quick Links | Entrez ID:9531; OMIM: 603883; Uniprot ID:BAG3_HUMAN; ENSEMBL ID: ENSG00000151929; HGNC ID: 939 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.523309
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 7 / 70761 | 98 | ![]() |
blastocyst | 3 / 62319 | 48 | ![]() |
fetus | 12 / 564012 | 21 | ![]() |
neonate | 4 / 31097 | 128 | ![]() |
infant | 1 / 23620 | 42 | ![]() |
juvenile | 7 / 55556 | 125 | ![]() |
adult | 157 / 1939121 | 80 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 0 / 17475 | 0 | |
breast (mammary gland) tumor | 9 / 94178 | 95 | ![]() |
cervical tumor | 1 / 34366 | 29 | ![]() |
chondrosarcoma | 8 / 82823 | 96 | ![]() |
colorectal tumor | 5 / 114246 | 43 | ![]() |
esophageal tumor | 2 / 17290 | 115 | ![]() |
gastrointestinal tumor | 10 / 119369 | 83 | ![]() |
germ cell tumor | 14 / 263845 | 53 | ![]() |
glioma | 16 / 106883 | 149 | ![]() |
head and neck tumor | 14 / 136302 | 102 | ![]() |
kidney tumor | 6 / 68959 | 87 | ![]() |
leukemia | 6 / 95842 | 62 | ![]() |
liver tumor | 4 / 96359 | 41 | ![]() |
lung tumor | 3 / 103127 | 29 | ![]() |
lymphoma | 0 / 71755 | 0 | |
non-neoplasia | 5 / 97250 | 51 | ![]() |
normal | 235 / 3360307 | 69 | ![]() |
ovarian tumor | 1 / 76682 | 13 | ![]() |
pancreatic tumor | 18 / 104616 | 172 | ![]() |
primitive neuroectodermal tumor of the CNS | 7 / 125680 | 55 | ![]() |
prostate cancer | 5 / 102680 | 48 | ![]() |
retinoblastoma | 0 / 46356 | 0 | |
skin tumor | 13 / 124949 | 104 | ![]() |
soft tissue/muscle tissue tumor | 3 / 125191 | 23 | ![]() |
uterine tumor | 9 / 90257 | 99 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 5 / 13106 | 381 | ![]() |
adrenal gland | 2 / 33197 | 60 | ![]() |
ascites | 1 / 40015 | 24 | ![]() |
bladder | 1 / 29757 | 33 | ![]() |
blood | 10 / 123478 | 80 | ![]() |
bone | 6 / 71655 | 83 | ![]() |
bone marrow | 5 / 48801 | 102 | ![]() |
brain | 60 / 1100989 | 54 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 7 / 149255 | 46 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 15 / 215722 | 69 | ![]() |
esophagus | 2 / 20209 | 98 | ![]() |
eye | 10 / 211054 | 47 | ![]() |
heart | 9 / 89626 | 100 | ![]() |
intestine | 12 / 234472 | 51 | ![]() |
kidney | 16 / 211777 | 75 | ![]() |
larynx | 0 / 24145 | 0 | |
liver | 6 / 207743 | 28 | ![]() |
lung | 20 / 336974 | 59 | ![]() |
lymph | 0 / 44270 | 0 | |
lymph node | 5 / 91610 | 54 | ![]() |
mammary gland | 12 / 153271 | 78 | ![]() |
mouth | 16 / 67052 | 238 | ![]() |
muscle | 6 / 107715 | 55 | ![]() |
nerve | 4 / 15768 | 253 | ![]() |
ovary | 1 / 102051 | 9 | ![]() |
pancreas | 26 / 214812 | 121 | ![]() |
parathyroid | 6 / 20539 | 292 | ![]() |
pharynx | 1 / 41328 | 24 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 20 / 280825 | 71 | ![]() |
prostate | 13 / 189345 | 68 | ![]() |
salivary gland | 0 / 20155 | 0 | |
skin | 29 / 210574 | 137 | ![]() |
spleen | 2 / 53952 | 37 | ![]() |
stomach | 9 / 96619 | 93 | ![]() |
testis | 17 / 330442 | 51 | ![]() |
thymus | 1 / 81131 | 12 | ![]() |
thyroid | 0 / 47473 | 0 | |
tonsil | 0 / 16999 | 0 | |
trachea | 3 / 52413 | 57 | ![]() |
umbilical cord | 1 / 13680 | 73 | ![]() |
uterus | 26 / 232878 | 111 | ![]() |
vascular | 19 / 51780 | 366 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 217911_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 12.9 | ![]() |
Adipocyte | 75.75 | ![]() |
AdrenalCortex | 24.2 | ![]() |
Adrenalgland | 35.05 | ![]() |
Amygdala | 61.35 | ![]() |
Appendix | 17.95 | ![]() |
AtrioventricularNode | 18.6 | ![]() |
BDCA4+_DentriticCells | 12.4 | ![]() |
Bonemarrow | 15.9 | ![]() |
BronchialEpithelialCells | 276.95 | ![]() |
CD105+_Endothelial | 11.65 | ![]() |
CD14+_Monocytes | 12.7 | ![]() |
CD19+_BCells(neg._sel.) | 13.75 | ![]() |
CD33+_Myeloid | 18.15 | ![]() |
CD34+ | 13.45 | ![]() |
CD4+_Tcells | 25.7 | ![]() |
CD56+_NKCells | 14.45 | ![]() |
CD71+_EarlyErythroid | 7.85 | ![]() |
CD8+_Tcells | 17.3 | ![]() |
CardiacMyocytes | 90.25 | ![]() |
Caudatenucleus | 25.6 | ![]() |
Cerebellum | 84.9 | ![]() |
CerebellumPeduncles | 40 | ![]() |
CiliaryGanglion | 40.35 | ![]() |
CingulateCortex | 18.1 | ![]() |
Colorectaladenocarcinoma | 34.15 | ![]() |
DorsalRootGanglion | 16.7 | ![]() |
FetalThyroid | 25.8 | ![]() |
Fetalbrain | 15.85 | ![]() |
Fetalliver | 13.35 | ![]() |
Fetallung | 31.15 | ![]() |
GlobusPallidus | 14.2 | ![]() |
Heart | 339.65 | ![]() |
Hypothalamus | 55.8 | ![]() |
Kidney | 58.35 | ![]() |
Leukemia_chronicMyelogenousK-562 | 19 | ![]() |
Leukemia_promyelocytic-HL-60 | 12.05 | ![]() |
Leukemialymphoblastic(MOLT-4) | 10.2 | ![]() |
Liver | 58.6 | ![]() |
Lung | 135.85 | ![]() |
Lymphnode | 15.3 | ![]() |
Lymphoma_burkitts(Daudi) | 13.6 | ![]() |
Lymphoma_burkitts(Raji) | 16.55 | ![]() |
MedullaOblongata | 14.55 | ![]() |
OccipitalLobe | 14.4 | ![]() |
OlfactoryBulb | 106.9 | ![]() |
Ovary | 10.7 | ![]() |
Pancreas | 27.5 | ![]() |
PancreaticIslet | 74.05 | ![]() |
ParietalLobe | 15.65 | ![]() |
Pituitary | 44.1 | ![]() |
Placenta | 156.55 | ![]() |
Pons | 15.65 | ![]() |
PrefrontalCortex | 69.1 | ![]() |
Prostate | 196 | ![]() |
Salivarygland | 15.1 | ![]() |
SkeletalMuscle | 221.75 | ![]() |
Skin | 16.95 | ![]() |
SmoothMuscle | 122.35 | ![]() |
Spinalcord | 123 | ![]() |
SubthalamicNucleus | 15.65 | ![]() |
SuperiorCervicalGanglion | 22.05 | ![]() |
TemporalLobe | 18.6 | ![]() |
Testis | 49.05 | ![]() |
TestisGermCell | 22.55 | ![]() |
TestisIntersitial | 19.75 | ![]() |
TestisLeydigCell | 20.05 | ![]() |
TestisSeminiferousTubule | 29.35 | ![]() |
Thalamus | 23.85 | ![]() |
Thymus | 23.1 | ![]() |
Thyroid | 76.85 | ![]() |
Tongue | 125.9 | ![]() |
Tonsil | 19.85 | ![]() |
Trachea | 61.45 | ![]() |
TrigeminalGanglion | 18.95 | ![]() |
Uterus | 116.9 | ![]() |
UterusCorpus | 24.9 | ![]() |
WholeBlood | 11.65 | ![]() |
Wholebrain | 18.55 | ![]() |
colon | 80.9 | ![]() |
pineal_day | 63.82 | ![]() |
pineal_night | 46.14 | ![]() |
retina | 86.45 | ![]() |
small_intestine | 44.4 | ![]() |
- Probe name: A_23_P47077
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.31 ± 0.54 | ![]() ![]() ![]() |
Basal Forebrain | 5.45 ± 0.37 | ![]() ![]() ![]() |
Basal Part of Pons | 5.6 ± 0.27 | ![]() ![]() ![]() |
Cerebellar Cortex | 5.29 ± 0.52 | ![]() ![]() ![]() |
Cerebellar Nuclei | 5.81 ± 0.41 | ![]() ![]() ![]() |
Claustrum | 5.13 ± 0.71 | ![]() ![]() ![]() |
Epithalamus | 5.72 ± 0.53 | ![]() ![]() ![]() |
Frontal Lobe | 4.91 ± 0.57 | ![]() ![]() ![]() |
Globus Pallidus | 6.69 ± 0.63 | ![]() ![]() ![]() |
Hypothalamus | 5.52 ± 0.64 | ![]() ![]() ![]() |
Insula | 4.99 ± 0.35 | ![]() ![]() ![]() |
Limbic Lobe | 5 ± 0.71 | ![]() ![]() ![]() |
Mesencephalon | 5.27 ± 0.7 | ![]() ![]() ![]() |
Myelencephalon | 5.24 ± 0.5 | ![]() ![]() ![]() |
Occipital Lobe | 5.06 ± 0.56 | ![]() ![]() ![]() |
Parietal Lobe | 4.95 ± 0.68 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.08 ± 0.7 | ![]() ![]() ![]() |
Striatum | 5.93 ± 0.8 | ![]() ![]() ![]() |
Subthalamus | 5.25 ± 0.38 | ![]() ![]() ![]() |
Temporal Lobe | 4.9 ± 0.57 | ![]() ![]() ![]() |
Thalamus | 5.29 ± 0.53 | ![]() ![]() ![]() |
White Matter | 5.45 ± 0.36 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Bag3 | CB | Cerebellum | 38.37 | ![]() |
62.63 | ![]() | |||
Bag3 | CTX | Cerebral cortex | 29.53 | ![]() |
21.55 | ![]() | |||
Bag3 | HIP | Hippocampal region | 18.53 | ![]() |
18.86 | ![]() | |||
Bag3 | HPF | Hippocampal formation | 21.93 | ![]() |
20.59 | ![]() | |||
Bag3 | HY | Hypothalamus | 3.21 | ![]() |
2.7 | ![]() | |||
Bag3 | LSX | Lateral septal complex | 3.6 | ![]() |
2.83 | ![]() | |||
Bag3 | MB | Midbrain | 5.44 | ![]() |
7.02 | ![]() | |||
Bag3 | MY | Medulla | 20.2 | ![]() |
31.03 | ![]() | |||
Bag3 | OLF | Olfactory bulb | 37.69 | ![]() |
30.89 | ![]() | |||
Bag3 | P | Pons | 22.35 | ![]() |
34.08 | ![]() | |||
Bag3 | PAL | Pallidum | 9.07 | ![]() |
10.46 | ![]() | |||
Bag3 | RHP | Retrohippocampal region | 28.2 | ![]() |
23.31 | ![]() | |||
Bag3 | sAMY | Striatum-like amygdalar nuclei | 9.95 | ![]() |
7.2 | ![]() | |||
Bag3 | STR | Striatum | 7.95 | ![]() |
5.91 | ![]() | |||
Bag3 | STRd | Striatum dorsal region | 7.55 | ![]() |
5.88 | ![]() | |||
Bag3 | STRv | Striatum ventral region | 10.3 | ![]() |
6.69 | ![]() | |||
Bag3 | TH | Thalamus | 6.52 | ![]() |
6.06 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
BAG3_HUMAN_194 | 10 | 194 | 203 | SSLGSHQLPR | PRIDE |
BAG3_HUMAN_80 | 26 | 80 | 105 | EGHPVYPQLRPGYIPIPVLHEGAENR | PRIDE |
PAp00002997 | 31 | 140 | 170 | GMPETTQPDKQCGQVAAAAAAQPPASHGPER | Peptide Atlas |