Annotation Detail for BAG3
Basic Information Top
| Gene Symbol: | BAG3 ( BAG-3,BIS,CAIR-1,MGC104307 ) |
|---|---|
| Gene Full Name: | BCL2-associated athanogene 3 |
| Band: | 10q26.11 |
| Quick Links | Entrez ID:9531; OMIM: 603883; Uniprot ID:BAG3_HUMAN; ENSEMBL ID: ENSG00000151929; HGNC ID: 939 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.523309
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 7 / 70761 | 98 | |
| blastocyst | 3 / 62319 | 48 | |
| fetus | 12 / 564012 | 21 | |
| neonate | 4 / 31097 | 128 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 7 / 55556 | 125 | |
| adult | 157 / 1939121 | 80 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 0 / 17475 | 0 | |
| breast (mammary gland) tumor | 9 / 94178 | 95 | |
| cervical tumor | 1 / 34366 | 29 | |
| chondrosarcoma | 8 / 82823 | 96 | |
| colorectal tumor | 5 / 114246 | 43 | |
| esophageal tumor | 2 / 17290 | 115 | |
| gastrointestinal tumor | 10 / 119369 | 83 | |
| germ cell tumor | 14 / 263845 | 53 | |
| glioma | 16 / 106883 | 149 | |
| head and neck tumor | 14 / 136302 | 102 | |
| kidney tumor | 6 / 68959 | 87 | |
| leukemia | 6 / 95842 | 62 | |
| liver tumor | 4 / 96359 | 41 | |
| lung tumor | 3 / 103127 | 29 | |
| lymphoma | 0 / 71755 | 0 | |
| non-neoplasia | 5 / 97250 | 51 | |
| normal | 235 / 3360307 | 69 | |
| ovarian tumor | 1 / 76682 | 13 | |
| pancreatic tumor | 18 / 104616 | 172 | |
| primitive neuroectodermal tumor of the CNS | 7 / 125680 | 55 | |
| prostate cancer | 5 / 102680 | 48 | |
| retinoblastoma | 0 / 46356 | 0 | |
| skin tumor | 13 / 124949 | 104 | |
| soft tissue/muscle tissue tumor | 3 / 125191 | 23 | |
| uterine tumor | 9 / 90257 | 99 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 5 / 13106 | 381 | |
| adrenal gland | 2 / 33197 | 60 | |
| ascites | 1 / 40015 | 24 | |
| bladder | 1 / 29757 | 33 | |
| blood | 10 / 123478 | 80 | |
| bone | 6 / 71655 | 83 | |
| bone marrow | 5 / 48801 | 102 | |
| brain | 60 / 1100989 | 54 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 7 / 149255 | 46 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 15 / 215722 | 69 | |
| esophagus | 2 / 20209 | 98 | |
| eye | 10 / 211054 | 47 | |
| heart | 9 / 89626 | 100 | |
| intestine | 12 / 234472 | 51 | |
| kidney | 16 / 211777 | 75 | |
| larynx | 0 / 24145 | 0 | |
| liver | 6 / 207743 | 28 | |
| lung | 20 / 336974 | 59 | |
| lymph | 0 / 44270 | 0 | |
| lymph node | 5 / 91610 | 54 | |
| mammary gland | 12 / 153271 | 78 | |
| mouth | 16 / 67052 | 238 | |
| muscle | 6 / 107715 | 55 | |
| nerve | 4 / 15768 | 253 | |
| ovary | 1 / 102051 | 9 | |
| pancreas | 26 / 214812 | 121 | |
| parathyroid | 6 / 20539 | 292 | |
| pharynx | 1 / 41328 | 24 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 20 / 280825 | 71 | |
| prostate | 13 / 189345 | 68 | |
| salivary gland | 0 / 20155 | 0 | |
| skin | 29 / 210574 | 137 | |
| spleen | 2 / 53952 | 37 | |
| stomach | 9 / 96619 | 93 | |
| testis | 17 / 330442 | 51 | |
| thymus | 1 / 81131 | 12 | |
| thyroid | 0 / 47473 | 0 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 3 / 52413 | 57 | |
| umbilical cord | 1 / 13680 | 73 | |
| uterus | 26 / 232878 | 111 | |
| vascular | 19 / 51780 | 366 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 217911_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 12.9 | |
| Adipocyte | 75.75 | |
| AdrenalCortex | 24.2 | |
| Adrenalgland | 35.05 | |
| Amygdala | 61.35 | |
| Appendix | 17.95 | |
| AtrioventricularNode | 18.6 | |
| BDCA4+_DentriticCells | 12.4 | |
| Bonemarrow | 15.9 | |
| BronchialEpithelialCells | 276.95 | |
| CD105+_Endothelial | 11.65 | |
| CD14+_Monocytes | 12.7 | |
| CD19+_BCells(neg._sel.) | 13.75 | |
| CD33+_Myeloid | 18.15 | |
| CD34+ | 13.45 | |
| CD4+_Tcells | 25.7 | |
| CD56+_NKCells | 14.45 | |
| CD71+_EarlyErythroid | 7.85 | |
| CD8+_Tcells | 17.3 | |
| CardiacMyocytes | 90.25 | |
| Caudatenucleus | 25.6 | |
| Cerebellum | 84.9 | |
| CerebellumPeduncles | 40 | |
| CiliaryGanglion | 40.35 | |
| CingulateCortex | 18.1 | |
| Colorectaladenocarcinoma | 34.15 | |
| DorsalRootGanglion | 16.7 | |
| FetalThyroid | 25.8 | |
| Fetalbrain | 15.85 | |
| Fetalliver | 13.35 | |
| Fetallung | 31.15 | |
| GlobusPallidus | 14.2 | |
| Heart | 339.65 | |
| Hypothalamus | 55.8 | |
| Kidney | 58.35 | |
| Leukemia_chronicMyelogenousK-562 | 19 | |
| Leukemia_promyelocytic-HL-60 | 12.05 | |
| Leukemialymphoblastic(MOLT-4) | 10.2 | |
| Liver | 58.6 | |
| Lung | 135.85 | |
| Lymphnode | 15.3 | |
| Lymphoma_burkitts(Daudi) | 13.6 | |
| Lymphoma_burkitts(Raji) | 16.55 | |
| MedullaOblongata | 14.55 | |
| OccipitalLobe | 14.4 | |
| OlfactoryBulb | 106.9 | |
| Ovary | 10.7 | |
| Pancreas | 27.5 | |
| PancreaticIslet | 74.05 | |
| ParietalLobe | 15.65 | |
| Pituitary | 44.1 | |
| Placenta | 156.55 | |
| Pons | 15.65 | |
| PrefrontalCortex | 69.1 | |
| Prostate | 196 | |
| Salivarygland | 15.1 | |
| SkeletalMuscle | 221.75 | |
| Skin | 16.95 | |
| SmoothMuscle | 122.35 | |
| Spinalcord | 123 | |
| SubthalamicNucleus | 15.65 | |
| SuperiorCervicalGanglion | 22.05 | |
| TemporalLobe | 18.6 | |
| Testis | 49.05 | |
| TestisGermCell | 22.55 | |
| TestisIntersitial | 19.75 | |
| TestisLeydigCell | 20.05 | |
| TestisSeminiferousTubule | 29.35 | |
| Thalamus | 23.85 | |
| Thymus | 23.1 | |
| Thyroid | 76.85 | |
| Tongue | 125.9 | |
| Tonsil | 19.85 | |
| Trachea | 61.45 | |
| TrigeminalGanglion | 18.95 | |
| Uterus | 116.9 | |
| UterusCorpus | 24.9 | |
| WholeBlood | 11.65 | |
| Wholebrain | 18.55 | |
| colon | 80.9 | |
| pineal_day | 63.82 | |
| pineal_night | 46.14 | |
| retina | 86.45 | |
| small_intestine | 44.4 |
- Probe name: A_23_P47077
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 5.31 ± 0.54 | |
| Basal Forebrain | 5.45 ± 0.37 | |
| Basal Part of Pons | 5.6 ± 0.27 | |
| Cerebellar Cortex | 5.29 ± 0.52 | |
| Cerebellar Nuclei | 5.81 ± 0.41 | |
| Claustrum | 5.13 ± 0.71 | |
| Epithalamus | 5.72 ± 0.53 | |
| Frontal Lobe | 4.91 ± 0.57 | |
| Globus Pallidus | 6.69 ± 0.63 | |
| Hypothalamus | 5.52 ± 0.64 | |
| Insula | 4.99 ± 0.35 | |
| Limbic Lobe | 5 ± 0.71 | |
| Mesencephalon | 5.27 ± 0.7 | |
| Myelencephalon | 5.24 ± 0.5 | |
| Occipital Lobe | 5.06 ± 0.56 | |
| Parietal Lobe | 4.95 ± 0.68 | |
| Pontine Tegmentum | 5.08 ± 0.7 | |
| Striatum | 5.93 ± 0.8 | |
| Subthalamus | 5.25 ± 0.38 | |
| Temporal Lobe | 4.9 ± 0.57 | |
| Thalamus | 5.29 ± 0.53 | |
| White Matter | 5.45 ± 0.36 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Bag3 | CB | Cerebellum | 38.37 | |
| 62.63 | ||||
| Bag3 | CTX | Cerebral cortex | 29.53 | |
| 21.55 | ||||
| Bag3 | HIP | Hippocampal region | 18.53 | |
| 18.86 | ||||
| Bag3 | HPF | Hippocampal formation | 21.93 | |
| 20.59 | ||||
| Bag3 | HY | Hypothalamus | 3.21 | |
| 2.7 | ||||
| Bag3 | LSX | Lateral septal complex | 3.6 | |
| 2.83 | ||||
| Bag3 | MB | Midbrain | 5.44 | |
| 7.02 | ||||
| Bag3 | MY | Medulla | 20.2 | |
| 31.03 | ||||
| Bag3 | OLF | Olfactory bulb | 37.69 | |
| 30.89 | ||||
| Bag3 | P | Pons | 22.35 | |
| 34.08 | ||||
| Bag3 | PAL | Pallidum | 9.07 | |
| 10.46 | ||||
| Bag3 | RHP | Retrohippocampal region | 28.2 | |
| 23.31 | ||||
| Bag3 | sAMY | Striatum-like amygdalar nuclei | 9.95 | |
| 7.2 | ||||
| Bag3 | STR | Striatum | 7.95 | |
| 5.91 | ||||
| Bag3 | STRd | Striatum dorsal region | 7.55 | |
| 5.88 | ||||
| Bag3 | STRv | Striatum ventral region | 10.3 | |
| 6.69 | ||||
| Bag3 | TH | Thalamus | 6.52 | |
| 6.06 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| BAG3_HUMAN_194 | 10 | 194 | 203 | SSLGSHQLPR | PRIDE |
| BAG3_HUMAN_80 | 26 | 80 | 105 | EGHPVYPQLRPGYIPIPVLHEGAENR | PRIDE |
| PAp00002997 | 31 | 140 | 170 | GMPETTQPDKQCGQVAAAAAAQPPASHGPER | Peptide Atlas |



