Annotation Detail for NCOR1
Basic Information Top
| Gene Symbol: | NCOR1 ( KIAA1047,MGC104216,N-CoR,N-CoR1,TRAC1,hN-CoR ) |
|---|---|
| Gene Full Name: | nuclear receptor corepressor 1 |
| Band: | 17p12-p11.2 |
| Quick Links | Entrez ID:9611; OMIM: 600849; Uniprot ID:NCOR1_HUMAN; ENSEMBL ID: ENSG00000141027; HGNC ID: 7672 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.462323
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 11 / 70761 | 155 | |
| blastocyst | 5 / 62319 | 80 | |
| fetus | 50 / 564012 | 88 | |
| neonate | 2 / 31097 | 64 | |
| infant | 1 / 23620 | 42 | |
| juvenile | 4 / 55556 | 71 | |
| adult | 228 / 1939121 | 117 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 3 / 12794 | 234 | |
| bladder carcinoma | 3 / 17475 | 171 | |
| breast (mammary gland) tumor | 9 / 94178 | 95 | |
| cervical tumor | 5 / 34366 | 145 | |
| chondrosarcoma | 5 / 82823 | 60 | |
| colorectal tumor | 23 / 114246 | 201 | |
| esophageal tumor | 4 / 17290 | 231 | |
| gastrointestinal tumor | 12 / 119369 | 100 | |
| germ cell tumor | 24 / 263845 | 90 | |
| glioma | 5 / 106883 | 46 | |
| head and neck tumor | 14 / 136302 | 102 | |
| kidney tumor | 8 / 68959 | 116 | |
| leukemia | 13 / 95842 | 135 | |
| liver tumor | 11 / 96359 | 114 | |
| lung tumor | 3 / 103127 | 29 | |
| lymphoma | 3 / 71755 | 41 | |
| non-neoplasia | 18 / 97250 | 185 | |
| normal | 289 / 3360307 | 86 | |
| ovarian tumor | 5 / 76682 | 65 | |
| pancreatic tumor | 4 / 104616 | 38 | |
| primitive neuroectodermal tumor of the CNS | 6 / 125680 | 47 | |
| prostate cancer | 10 / 102680 | 97 | |
| retinoblastoma | 4 / 46356 | 86 | |
| skin tumor | 6 / 124949 | 48 | |
| soft tissue/muscle tissue tumor | 14 / 125191 | 111 | |
| uterine tumor | 19 / 90257 | 210 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 3 / 13106 | 228 | |
| adrenal gland | 5 / 33197 | 150 | |
| ascites | 3 / 40015 | 74 | |
| bladder | 5 / 29757 | 168 | |
| blood | 13 / 123478 | 105 | |
| bone | 9 / 71655 | 125 | |
| bone marrow | 4 / 48801 | 81 | |
| brain | 89 / 1100989 | 80 | |
| cervix | 5 / 48171 | 103 | |
| connective tissue | 6 / 149255 | 40 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 25 / 215722 | 115 | |
| esophagus | 4 / 20209 | 197 | |
| eye | 20 / 211054 | 94 | |
| heart | 7 / 89626 | 78 | |
| intestine | 42 / 234472 | 179 | |
| kidney | 24 / 211777 | 113 | |
| larynx | 4 / 24145 | 165 | |
| liver | 19 / 207743 | 91 | |
| lung | 34 / 336974 | 100 | |
| lymph | 1 / 44270 | 22 | |
| lymph node | 14 / 91610 | 152 | |
| mammary gland | 13 / 153271 | 84 | |
| mouth | 7 / 67052 | 104 | |
| muscle | 8 / 107715 | 74 | |
| nerve | 0 / 15768 | 0 | |
| ovary | 6 / 102051 | 58 | |
| pancreas | 4 / 214812 | 18 | |
| parathyroid | 1 / 20539 | 48 | |
| pharynx | 0 / 41328 | 0 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 24 / 280825 | 85 | |
| prostate | 21 / 189345 | 110 | |
| salivary gland | 1 / 20155 | 49 | |
| skin | 10 / 210574 | 47 | |
| spleen | 1 / 53952 | 18 | |
| stomach | 14 / 96619 | 144 | |
| testis | 36 / 330442 | 108 | |
| thymus | 7 / 81131 | 86 | |
| thyroid | 7 / 47473 | 147 | |
| tonsil | 0 / 16999 | 0 | |
| trachea | 3 / 52413 | 57 | |
| umbilical cord | 0 / 13680 | 0 | |
| uterus | 30 / 232878 | 128 | |
| vascular | 4 / 51780 | 77 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 200854_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 199 | |
| Adipocyte | 24.7 | |
| AdrenalCortex | 27.25 | |
| Adrenalgland | 37.7 | |
| Amygdala | 60.4 | |
| Appendix | 30.15 | |
| AtrioventricularNode | 26 | |
| BDCA4+_DentriticCells | 117.35 | |
| Bonemarrow | 34.2 | |
| BronchialEpithelialCells | 20.95 | |
| CD105+_Endothelial | 84.6 | |
| CD14+_Monocytes | 83.15 | |
| CD19+_BCells(neg._sel.) | 127.15 | |
| CD33+_Myeloid | 121.4 | |
| CD34+ | 207.1 | |
| CD4+_Tcells | 132.65 | |
| CD56+_NKCells | 206.5 | |
| CD71+_EarlyErythroid | 69.4 | |
| CD8+_Tcells | 142.7 | |
| CardiacMyocytes | 34.15 | |
| Caudatenucleus | 53.75 | |
| Cerebellum | 49.85 | |
| CerebellumPeduncles | 77.45 | |
| CiliaryGanglion | 23.95 | |
| CingulateCortex | 41.2 | |
| Colorectaladenocarcinoma | 43.25 | |
| DorsalRootGanglion | 22.45 | |
| FetalThyroid | 55.15 | |
| Fetalbrain | 74.45 | |
| Fetalliver | 34.6 | |
| Fetallung | 51.65 | |
| GlobusPallidus | 37.15 | |
| Heart | 18.15 | |
| Hypothalamus | 47.65 | |
| Kidney | 55.7 | |
| Leukemia_chronicMyelogenousK-562 | 30.7 | |
| Leukemia_promyelocytic-HL-60 | 34.5 | |
| Leukemialymphoblastic(MOLT-4) | 56.75 | |
| Liver | 28.65 | |
| Lung | 25.55 | |
| Lymphnode | 49.4 | |
| Lymphoma_burkitts(Daudi) | 58.9 | |
| Lymphoma_burkitts(Raji) | 24.8 | |
| MedullaOblongata | 61.9 | |
| OccipitalLobe | 57.7 | |
| OlfactoryBulb | 45.8 | |
| Ovary | 30.5 | |
| Pancreas | 32.05 | |
| PancreaticIslet | 43 | |
| ParietalLobe | 48.95 | |
| Pituitary | 53.3 | |
| Placenta | 43.55 | |
| Pons | 32.8 | |
| PrefrontalCortex | 103.35 | |
| Prostate | 48.65 | |
| Salivarygland | 38.25 | |
| SkeletalMuscle | 42.55 | |
| Skin | 31.05 | |
| SmoothMuscle | 27.9 | |
| Spinalcord | 49.35 | |
| SubthalamicNucleus | 38.85 | |
| SuperiorCervicalGanglion | 29.55 | |
| TemporalLobe | 44.9 | |
| Testis | 40.85 | |
| TestisGermCell | 47.25 | |
| TestisIntersitial | 38.35 | |
| TestisLeydigCell | 47.95 | |
| TestisSeminiferousTubule | 40.75 | |
| Thalamus | 46.6 | |
| Thymus | 84 | |
| Thyroid | 61.45 | |
| Tongue | 28.8 | |
| Tonsil | 45.7 | |
| Trachea | 35.55 | |
| TrigeminalGanglion | 28.45 | |
| Uterus | 47.45 | |
| UterusCorpus | 50.75 | |
| WholeBlood | 88.6 | |
| Wholebrain | 44.9 | |
| colon | 48.5 | |
| pineal_day | 237.28 | |
| pineal_night | 206.46 | |
| retina | 67.025 | |
| small_intestine | 58.9 |
- Probe name: A_24_P204214
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 9.86 ± 0.15 | |
| Basal Forebrain | 9.92 ± 0.1 | |
| Basal Part of Pons | 9.71 ± 0.17 | |
| Cerebellar Cortex | 9.96 ± 0.13 | |
| Cerebellar Nuclei | 9.72 ± 0.23 | |
| Claustrum | 9.98 ± 0.17 | |
| Epithalamus | 9.9 ± 0.12 | |
| Frontal Lobe | 9.74 ± 0.21 | |
| Globus Pallidus | 9.82 ± 0.13 | |
| Hypothalamus | 9.76 ± 0.19 | |
| Insula | 9.85 ± 0.18 | |
| Limbic Lobe | 9.8 ± 0.23 | |
| Mesencephalon | 9.78 ± 0.21 | |
| Myelencephalon | 9.78 ± 0.21 | |
| Occipital Lobe | 9.93 ± 0.14 | |
| Parietal Lobe | 9.86 ± 0.21 | |
| Pontine Tegmentum | 9.81 ± 0.21 | |
| Striatum | 9.67 ± 0.16 | |
| Subthalamus | 9.65 ± 0.13 | |
| Temporal Lobe | 9.84 ± 0.18 | |
| Thalamus | 9.78 ± 0.14 | |
| White Matter | 10.35 ± 0.17 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Ncor1 | CB | Cerebellum | 29.41 | |
| 23.95 | ||||
| Ncor1 | CTX | Cerebral cortex | 11.76 | |
| 7.61 | ||||
| Ncor1 | HIP | Hippocampal region | 56.05 | |
| 48.47 | ||||
| Ncor1 | HPF | Hippocampal formation | 42.24 | |
| 34 | ||||
| Ncor1 | HY | Hypothalamus | 3.12 | |
| 1.79 | ||||
| Ncor1 | LSX | Lateral septal complex | 3.29 | |
| 2.09 | ||||
| Ncor1 | MB | Midbrain | 2.03 | |
| 1.5 | ||||
| Ncor1 | MY | Medulla | 3.68 | |
| 2.77 | ||||
| Ncor1 | OLF | Olfactory bulb | 47.25 | |
| 27.34 | ||||
| Ncor1 | P | Pons | 4.27 | |
| 3.43 | ||||
| Ncor1 | PAL | Pallidum | 1.41 | |
| 0.85 | ||||
| Ncor1 | RHP | Retrohippocampal region | 20.31 | |
| 14.57 | ||||
| Ncor1 | sAMY | Striatum-like amygdalar nuclei | 2.96 | |
| 1.87 | ||||
| Ncor1 | STR | Striatum | 3.05 | |
| 1.85 | ||||
| Ncor1 | STRd | Striatum dorsal region | 1.32 | |
| 0.87 | ||||
| Ncor1 | STRv | Striatum ventral region | 8.77 | |
| 4.56 | ||||
| Ncor1 | TH | Thalamus | 3.99 | |
| 2.56 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| NCOR1_HUMAN_1350 | 7 | 1350 | 1356 | SIHEIPR | PRIDE |
| NCOR1_HUMAN_234 | 11 | 234 | 244 | SIVQIIYDENR | PRIDE |
| PAp00011342 | 30 | 1876 | 1905 | RSVQCLYTSSAFPSGKPQPHSSVVYSEAGK | Peptide Atlas |



