Annotation Detail for NCOR1


Gene Symbol: | NCOR1 ( KIAA1047,MGC104216,N-CoR,N-CoR1,TRAC1,hN-CoR ) |
---|---|
Gene Full Name: | nuclear receptor corepressor 1 |
Band: | 17p12-p11.2 |
Quick Links | Entrez ID:9611; OMIM: 600849; Uniprot ID:NCOR1_HUMAN; ENSEMBL ID: ENSG00000141027; HGNC ID: 7672 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.462323
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 11 / 70761 | 155 | ![]() |
blastocyst | 5 / 62319 | 80 | ![]() |
fetus | 50 / 564012 | 88 | ![]() |
neonate | 2 / 31097 | 64 | ![]() |
infant | 1 / 23620 | 42 | ![]() |
juvenile | 4 / 55556 | 71 | ![]() |
adult | 228 / 1939121 | 117 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 3 / 12794 | 234 | ![]() |
bladder carcinoma | 3 / 17475 | 171 | ![]() |
breast (mammary gland) tumor | 9 / 94178 | 95 | ![]() |
cervical tumor | 5 / 34366 | 145 | ![]() |
chondrosarcoma | 5 / 82823 | 60 | ![]() |
colorectal tumor | 23 / 114246 | 201 | ![]() |
esophageal tumor | 4 / 17290 | 231 | ![]() |
gastrointestinal tumor | 12 / 119369 | 100 | ![]() |
germ cell tumor | 24 / 263845 | 90 | ![]() |
glioma | 5 / 106883 | 46 | ![]() |
head and neck tumor | 14 / 136302 | 102 | ![]() |
kidney tumor | 8 / 68959 | 116 | ![]() |
leukemia | 13 / 95842 | 135 | ![]() |
liver tumor | 11 / 96359 | 114 | ![]() |
lung tumor | 3 / 103127 | 29 | ![]() |
lymphoma | 3 / 71755 | 41 | ![]() |
non-neoplasia | 18 / 97250 | 185 | ![]() |
normal | 289 / 3360307 | 86 | ![]() |
ovarian tumor | 5 / 76682 | 65 | ![]() |
pancreatic tumor | 4 / 104616 | 38 | ![]() |
primitive neuroectodermal tumor of the CNS | 6 / 125680 | 47 | ![]() |
prostate cancer | 10 / 102680 | 97 | ![]() |
retinoblastoma | 4 / 46356 | 86 | ![]() |
skin tumor | 6 / 124949 | 48 | ![]() |
soft tissue/muscle tissue tumor | 14 / 125191 | 111 | ![]() |
uterine tumor | 19 / 90257 | 210 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 3 / 13106 | 228 | ![]() |
adrenal gland | 5 / 33197 | 150 | ![]() |
ascites | 3 / 40015 | 74 | ![]() |
bladder | 5 / 29757 | 168 | ![]() |
blood | 13 / 123478 | 105 | ![]() |
bone | 9 / 71655 | 125 | ![]() |
bone marrow | 4 / 48801 | 81 | ![]() |
brain | 89 / 1100989 | 80 | ![]() |
cervix | 5 / 48171 | 103 | ![]() |
connective tissue | 6 / 149255 | 40 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 25 / 215722 | 115 | ![]() |
esophagus | 4 / 20209 | 197 | ![]() |
eye | 20 / 211054 | 94 | ![]() |
heart | 7 / 89626 | 78 | ![]() |
intestine | 42 / 234472 | 179 | ![]() |
kidney | 24 / 211777 | 113 | ![]() |
larynx | 4 / 24145 | 165 | ![]() |
liver | 19 / 207743 | 91 | ![]() |
lung | 34 / 336974 | 100 | ![]() |
lymph | 1 / 44270 | 22 | ![]() |
lymph node | 14 / 91610 | 152 | ![]() |
mammary gland | 13 / 153271 | 84 | ![]() |
mouth | 7 / 67052 | 104 | ![]() |
muscle | 8 / 107715 | 74 | ![]() |
nerve | 0 / 15768 | 0 | |
ovary | 6 / 102051 | 58 | ![]() |
pancreas | 4 / 214812 | 18 | ![]() |
parathyroid | 1 / 20539 | 48 | ![]() |
pharynx | 0 / 41328 | 0 | |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 24 / 280825 | 85 | ![]() |
prostate | 21 / 189345 | 110 | ![]() |
salivary gland | 1 / 20155 | 49 | ![]() |
skin | 10 / 210574 | 47 | ![]() |
spleen | 1 / 53952 | 18 | ![]() |
stomach | 14 / 96619 | 144 | ![]() |
testis | 36 / 330442 | 108 | ![]() |
thymus | 7 / 81131 | 86 | ![]() |
thyroid | 7 / 47473 | 147 | ![]() |
tonsil | 0 / 16999 | 0 | |
trachea | 3 / 52413 | 57 | ![]() |
umbilical cord | 0 / 13680 | 0 | |
uterus | 30 / 232878 | 128 | ![]() |
vascular | 4 / 51780 | 77 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 200854_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 199 | ![]() |
Adipocyte | 24.7 | ![]() |
AdrenalCortex | 27.25 | ![]() |
Adrenalgland | 37.7 | ![]() |
Amygdala | 60.4 | ![]() |
Appendix | 30.15 | ![]() |
AtrioventricularNode | 26 | ![]() |
BDCA4+_DentriticCells | 117.35 | ![]() |
Bonemarrow | 34.2 | ![]() |
BronchialEpithelialCells | 20.95 | ![]() |
CD105+_Endothelial | 84.6 | ![]() |
CD14+_Monocytes | 83.15 | ![]() |
CD19+_BCells(neg._sel.) | 127.15 | ![]() |
CD33+_Myeloid | 121.4 | ![]() |
CD34+ | 207.1 | ![]() |
CD4+_Tcells | 132.65 | ![]() |
CD56+_NKCells | 206.5 | ![]() |
CD71+_EarlyErythroid | 69.4 | ![]() |
CD8+_Tcells | 142.7 | ![]() |
CardiacMyocytes | 34.15 | ![]() |
Caudatenucleus | 53.75 | ![]() |
Cerebellum | 49.85 | ![]() |
CerebellumPeduncles | 77.45 | ![]() |
CiliaryGanglion | 23.95 | ![]() |
CingulateCortex | 41.2 | ![]() |
Colorectaladenocarcinoma | 43.25 | ![]() |
DorsalRootGanglion | 22.45 | ![]() |
FetalThyroid | 55.15 | ![]() |
Fetalbrain | 74.45 | ![]() |
Fetalliver | 34.6 | ![]() |
Fetallung | 51.65 | ![]() |
GlobusPallidus | 37.15 | ![]() |
Heart | 18.15 | ![]() |
Hypothalamus | 47.65 | ![]() |
Kidney | 55.7 | ![]() |
Leukemia_chronicMyelogenousK-562 | 30.7 | ![]() |
Leukemia_promyelocytic-HL-60 | 34.5 | ![]() |
Leukemialymphoblastic(MOLT-4) | 56.75 | ![]() |
Liver | 28.65 | ![]() |
Lung | 25.55 | ![]() |
Lymphnode | 49.4 | ![]() |
Lymphoma_burkitts(Daudi) | 58.9 | ![]() |
Lymphoma_burkitts(Raji) | 24.8 | ![]() |
MedullaOblongata | 61.9 | ![]() |
OccipitalLobe | 57.7 | ![]() |
OlfactoryBulb | 45.8 | ![]() |
Ovary | 30.5 | ![]() |
Pancreas | 32.05 | ![]() |
PancreaticIslet | 43 | ![]() |
ParietalLobe | 48.95 | ![]() |
Pituitary | 53.3 | ![]() |
Placenta | 43.55 | ![]() |
Pons | 32.8 | ![]() |
PrefrontalCortex | 103.35 | ![]() |
Prostate | 48.65 | ![]() |
Salivarygland | 38.25 | ![]() |
SkeletalMuscle | 42.55 | ![]() |
Skin | 31.05 | ![]() |
SmoothMuscle | 27.9 | ![]() |
Spinalcord | 49.35 | ![]() |
SubthalamicNucleus | 38.85 | ![]() |
SuperiorCervicalGanglion | 29.55 | ![]() |
TemporalLobe | 44.9 | ![]() |
Testis | 40.85 | ![]() |
TestisGermCell | 47.25 | ![]() |
TestisIntersitial | 38.35 | ![]() |
TestisLeydigCell | 47.95 | ![]() |
TestisSeminiferousTubule | 40.75 | ![]() |
Thalamus | 46.6 | ![]() |
Thymus | 84 | ![]() |
Thyroid | 61.45 | ![]() |
Tongue | 28.8 | ![]() |
Tonsil | 45.7 | ![]() |
Trachea | 35.55 | ![]() |
TrigeminalGanglion | 28.45 | ![]() |
Uterus | 47.45 | ![]() |
UterusCorpus | 50.75 | ![]() |
WholeBlood | 88.6 | ![]() |
Wholebrain | 44.9 | ![]() |
colon | 48.5 | ![]() |
pineal_day | 237.28 | ![]() |
pineal_night | 206.46 | ![]() |
retina | 67.025 | ![]() |
small_intestine | 58.9 | ![]() |
- Probe name: A_24_P204214
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 9.86 ± 0.15 | ![]() ![]() ![]() |
Basal Forebrain | 9.92 ± 0.1 | ![]() ![]() ![]() |
Basal Part of Pons | 9.71 ± 0.17 | ![]() ![]() ![]() |
Cerebellar Cortex | 9.96 ± 0.13 | ![]() ![]() ![]() |
Cerebellar Nuclei | 9.72 ± 0.23 | ![]() ![]() ![]() |
Claustrum | 9.98 ± 0.17 | ![]() ![]() ![]() |
Epithalamus | 9.9 ± 0.12 | ![]() ![]() ![]() |
Frontal Lobe | 9.74 ± 0.21 | ![]() ![]() ![]() |
Globus Pallidus | 9.82 ± 0.13 | ![]() ![]() ![]() |
Hypothalamus | 9.76 ± 0.19 | ![]() ![]() ![]() |
Insula | 9.85 ± 0.18 | ![]() ![]() ![]() |
Limbic Lobe | 9.8 ± 0.23 | ![]() ![]() ![]() |
Mesencephalon | 9.78 ± 0.21 | ![]() ![]() ![]() |
Myelencephalon | 9.78 ± 0.21 | ![]() ![]() ![]() |
Occipital Lobe | 9.93 ± 0.14 | ![]() ![]() ![]() |
Parietal Lobe | 9.86 ± 0.21 | ![]() ![]() ![]() |
Pontine Tegmentum | 9.81 ± 0.21 | ![]() ![]() ![]() |
Striatum | 9.67 ± 0.16 | ![]() ![]() ![]() |
Subthalamus | 9.65 ± 0.13 | ![]() ![]() ![]() |
Temporal Lobe | 9.84 ± 0.18 | ![]() ![]() ![]() |
Thalamus | 9.78 ± 0.14 | ![]() ![]() ![]() |
White Matter | 10.35 ± 0.17 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Ncor1 | CB | Cerebellum | 29.41 | ![]() |
23.95 | ![]() | |||
Ncor1 | CTX | Cerebral cortex | 11.76 | ![]() |
7.61 | ![]() | |||
Ncor1 | HIP | Hippocampal region | 56.05 | ![]() |
48.47 | ![]() | |||
Ncor1 | HPF | Hippocampal formation | 42.24 | ![]() |
34 | ![]() | |||
Ncor1 | HY | Hypothalamus | 3.12 | ![]() |
1.79 | ![]() | |||
Ncor1 | LSX | Lateral septal complex | 3.29 | ![]() |
2.09 | ![]() | |||
Ncor1 | MB | Midbrain | 2.03 | ![]() |
1.5 | ![]() | |||
Ncor1 | MY | Medulla | 3.68 | ![]() |
2.77 | ![]() | |||
Ncor1 | OLF | Olfactory bulb | 47.25 | ![]() |
27.34 | ![]() | |||
Ncor1 | P | Pons | 4.27 | ![]() |
3.43 | ![]() | |||
Ncor1 | PAL | Pallidum | 1.41 | ![]() |
0.85 | ![]() | |||
Ncor1 | RHP | Retrohippocampal region | 20.31 | ![]() |
14.57 | ![]() | |||
Ncor1 | sAMY | Striatum-like amygdalar nuclei | 2.96 | ![]() |
1.87 | ![]() | |||
Ncor1 | STR | Striatum | 3.05 | ![]() |
1.85 | ![]() | |||
Ncor1 | STRd | Striatum dorsal region | 1.32 | ![]() |
0.87 | ![]() | |||
Ncor1 | STRv | Striatum ventral region | 8.77 | ![]() |
4.56 | ![]() | |||
Ncor1 | TH | Thalamus | 3.99 | ![]() |
2.56 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
NCOR1_HUMAN_1350 | 7 | 1350 | 1356 | SIHEIPR | PRIDE |
NCOR1_HUMAN_234 | 11 | 234 | 244 | SIVQIIYDENR | PRIDE |
PAp00011342 | 30 | 1876 | 1905 | RSVQCLYTSSAFPSGKPQPHSSVVYSEAGK | Peptide Atlas |