Annotation Detail for MED24
Basic Information Top
| Gene Symbol: | MED24 ( ARC100,CRSP100,CRSP4,DRIP100,KIAA0130,MGC8748,THRAP4,TRAP100,hTRAP100 ) |
|---|---|
| Gene Full Name: | mediator complex subunit 24 |
| Band: | 17q21.1 |
| Quick Links | Entrez ID:9862; OMIM: 607000; Uniprot ID:MED24_HUMAN; ENSEMBL ID: ENSG00000008838; HGNC ID: 22963 |
| Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.462983
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| embryoid body | 16 / 70761 | 226 | |
| blastocyst | 11 / 62319 | 176 | |
| fetus | 153 / 564012 | 271 | |
| neonate | 5 / 31097 | 160 | |
| infant | 2 / 23620 | 84 | |
| juvenile | 5 / 55556 | 89 | |
| adult | 306 / 1939121 | 157 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adrenal tumor | 1 / 12794 | 78 | |
| bladder carcinoma | 1 / 17475 | 57 | |
| breast (mammary gland) tumor | 29 / 94178 | 307 | |
| cervical tumor | 1 / 34366 | 29 | |
| chondrosarcoma | 7 / 82823 | 84 | |
| colorectal tumor | 3 / 114246 | 26 | |
| esophageal tumor | 0 / 17290 | 0 | |
| gastrointestinal tumor | 15 / 119369 | 125 | |
| germ cell tumor | 134 / 263845 | 507 | |
| glioma | 20 / 106883 | 187 | |
| head and neck tumor | 82 / 136302 | 601 | |
| kidney tumor | 6 / 68959 | 87 | |
| leukemia | 6 / 95842 | 62 | |
| liver tumor | 17 / 96359 | 176 | |
| lung tumor | 7 / 103127 | 67 | |
| lymphoma | 1 / 71755 | 13 | |
| non-neoplasia | 11 / 97250 | 113 | |
| normal | 829 / 3360307 | 246 | |
| ovarian tumor | 1 / 76682 | 13 | |
| pancreatic tumor | 8 / 104616 | 76 | |
| primitive neuroectodermal tumor of the CNS | 10 / 125680 | 79 | |
| prostate cancer | 8 / 102680 | 77 | |
| retinoblastoma | 4 / 46356 | 86 | |
| skin tumor | 32 / 124949 | 256 | |
| soft tissue/muscle tissue tumor | 7 / 125191 | 55 | |
| uterine tumor | 4 / 90257 | 44 |
| Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
|---|---|---|---|
![]() | |||
| adipose tissue | 1 / 13106 | 76 | |
| adrenal gland | 5 / 33197 | 150 | |
| ascites | 3 / 40015 | 74 | |
| bladder | 3 / 29757 | 100 | |
| blood | 8 / 123478 | 64 | |
| bone | 4 / 71655 | 55 | |
| bone marrow | 4 / 48801 | 81 | |
| brain | 594 / 1100989 | 539 | |
| cervix | 1 / 48171 | 20 | |
| connective tissue | 18 / 149255 | 120 | |
| ear | 0 / 16212 | 0 | |
| embryonic tissue | 35 / 215722 | 162 | |
| esophagus | 0 / 20209 | 0 | |
| eye | 19 / 211054 | 90 | |
| heart | 3 / 89626 | 33 | |
| intestine | 24 / 234472 | 102 | |
| kidney | 20 / 211777 | 94 | |
| larynx | 4 / 24145 | 165 | |
| liver | 22 / 207743 | 105 | |
| lung | 45 / 336974 | 133 | |
| lymph | 1 / 44270 | 22 | |
| lymph node | 13 / 91610 | 141 | |
| mammary gland | 38 / 153271 | 247 | |
| mouth | 74 / 67052 | 1103 | |
| muscle | 7 / 107715 | 64 | |
| nerve | 1 / 15768 | 63 | |
| ovary | 4 / 102051 | 39 | |
| pancreas | 13 / 214812 | 60 | |
| parathyroid | 0 / 20539 | 0 | |
| pharynx | 1 / 41328 | 24 | |
| pituitary gland | 1 / 16585 | 60 | |
| placenta | 55 / 280825 | 195 | |
| prostate | 13 / 189345 | 68 | |
| salivary gland | 2 / 20155 | 99 | |
| skin | 36 / 210574 | 170 | |
| spleen | 10 / 53952 | 185 | |
| stomach | 9 / 96619 | 93 | |
| testis | 308 / 330442 | 932 | |
| thymus | 68 / 81131 | 838 | |
| thyroid | 5 / 47473 | 105 | |
| tonsil | 3 / 16999 | 176 | |
| trachea | 57 / 52413 | 1087 | |
| umbilical cord | 4 / 13680 | 292 | |
| uterus | 39 / 232878 | 167 | |
| vascular | 8 / 51780 | 154 |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 213043_s_at
| Cell line | Expression level | Expression bar |
|---|---|---|
![]() | ||
| 721_B_lymphoblasts | 44.2 | |
| Adipocyte | 5.8 | |
| AdrenalCortex | 5.2 | |
| Adrenalgland | 6.5 | |
| Amygdala | 10.55 | |
| Appendix | 5.25 | |
| AtrioventricularNode | 4.35 | |
| BDCA4+_DentriticCells | 25.45 | |
| Bonemarrow | 7 | |
| BronchialEpithelialCells | 77.4 | |
| CD105+_Endothelial | 66.85 | |
| CD14+_Monocytes | 9.35 | |
| CD19+_BCells(neg._sel.) | 10.25 | |
| CD33+_Myeloid | 16.5 | |
| CD34+ | 66.95 | |
| CD4+_Tcells | 16.05 | |
| CD56+_NKCells | 44.8 | |
| CD71+_EarlyErythroid | 43.8 | |
| CD8+_Tcells | 22.9 | |
| CardiacMyocytes | 7.35 | |
| Caudatenucleus | 6 | |
| Cerebellum | 5.85 | |
| CerebellumPeduncles | 8.85 | |
| CiliaryGanglion | 4.75 | |
| CingulateCortex | 9.55 | |
| Colorectaladenocarcinoma | 31.8 | |
| DorsalRootGanglion | 4 | |
| FetalThyroid | 6.7 | |
| Fetalbrain | 15.45 | |
| Fetalliver | 5.65 | |
| Fetallung | 43.55 | |
| GlobusPallidus | 4.7 | |
| Heart | 18.5 | |
| Hypothalamus | 12.95 | |
| Kidney | 5.25 | |
| Leukemia_chronicMyelogenousK-562 | 13.5 | |
| Leukemia_promyelocytic-HL-60 | 9 | |
| Leukemialymphoblastic(MOLT-4) | 40.85 | |
| Liver | 9.7 | |
| Lung | 33.5 | |
| Lymphnode | 6.65 | |
| Lymphoma_burkitts(Daudi) | 16.25 | |
| Lymphoma_burkitts(Raji) | 50.1 | |
| MedullaOblongata | 6.5 | |
| OccipitalLobe | 7 | |
| OlfactoryBulb | 6.05 | |
| Ovary | 3.9 | |
| Pancreas | 7.15 | |
| PancreaticIslet | 7.4 | |
| ParietalLobe | 7.55 | |
| Pituitary | 7.25 | |
| Placenta | 10.45 | |
| Pons | 5.6 | |
| PrefrontalCortex | 16.3 | |
| Prostate | 13.85 | |
| Salivarygland | 4.85 | |
| SkeletalMuscle | 7.75 | |
| Skin | 4.4 | |
| SmoothMuscle | 6.7 | |
| Spinalcord | 7.35 | |
| SubthalamicNucleus | 5.95 | |
| SuperiorCervicalGanglion | 5.6 | |
| TemporalLobe | 5.25 | |
| Testis | 12.45 | |
| TestisGermCell | 18 | |
| TestisIntersitial | 6.95 | |
| TestisLeydigCell | 7 | |
| TestisSeminiferousTubule | 8.7 | |
| Thalamus | 7.45 | |
| Thymus | 21.3 | |
| Thyroid | 15.45 | |
| Tongue | 6.3 | |
| Tonsil | 6.5 | |
| Trachea | 7.95 | |
| TrigeminalGanglion | 4.5 | |
| Uterus | 10.7 | |
| UterusCorpus | 5.95 | |
| WholeBlood | 6.7 | |
| Wholebrain | 14.75 | |
| colon | 7.45 | |
| pineal_day | 34.3 | |
| pineal_night | 27.24 | |
| retina | 13.975 | |
| small_intestine | 9.45 |
- Probe name: A_23_P124760
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
| Tissue | Expression(mean ± stddev) | Expression Bar |
|---|---|---|
| Amygdala | 5.77 ± 0.39 | |
| Basal Forebrain | 5.59 ± 0.33 | |
| Basal Part of Pons | 5.89 ± 0.38 | |
| Cerebellar Cortex | 5.84 ± 0.4 | |
| Cerebellar Nuclei | 5.97 ± 0.41 | |
| Claustrum | 5.81 ± 0.45 | |
| Epithalamus | 5.35 ± 0.25 | |
| Frontal Lobe | 5.84 ± 0.41 | |
| Globus Pallidus | 5.38 ± 0.33 | |
| Hypothalamus | 5.45 ± 0.51 | |
| Insula | 5.91 ± 0.32 | |
| Limbic Lobe | 5.74 ± 0.35 | |
| Mesencephalon | 5.66 ± 0.41 | |
| Myelencephalon | 5.76 ± 0.41 | |
| Occipital Lobe | 5.4 ± 0.32 | |
| Parietal Lobe | 5.64 ± 0.3 | |
| Pontine Tegmentum | 5.61 ± 0.41 | |
| Striatum | 5.42 ± 0.35 | |
| Subthalamus | 5.87 ± 0.29 | |
| Temporal Lobe | 5.9 ± 0.38 | |
| Thalamus | 5.82 ± 0.46 | |
| White Matter | 5.38 ± 0.35 |
| Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
|---|---|---|---|---|
| Thrap4 | CB | Cerebellum | 16.95 | |
| 13.46 | ||||
| Thrap4 | CTX | Cerebral cortex | 48.12 | |
| 33.69 | ||||
| Thrap4 | HIP | Hippocampal region | 55.75 | |
| 50.09 | ||||
| Thrap4 | HPF | Hippocampal formation | 55.49 | |
| 45.61 | ||||
| Thrap4 | HY | Hypothalamus | 5.39 | |
| 3.18 | ||||
| Thrap4 | LSX | Lateral septal complex | 6.42 | |
| 3.56 | ||||
| Thrap4 | MB | Midbrain | 7.67 | |
| 4.92 | ||||
| Thrap4 | MY | Medulla | 18.92 | |
| 13.86 | ||||
| Thrap4 | OLF | Olfactory bulb | 62.42 | |
| 43.7 | ||||
| Thrap4 | P | Pons | 11.69 | |
| 8.29 | ||||
| Thrap4 | PAL | Pallidum | 6.84 | |
| 4.58 | ||||
| Thrap4 | RHP | Retrohippocampal region | 55.26 | |
| 39.86 | ||||
| Thrap4 | sAMY | Striatum-like amygdalar nuclei | 10.58 | |
| 6.35 | ||||
| Thrap4 | STR | Striatum | 11.29 | |
| 6.52 | ||||
| Thrap4 | STRd | Striatum dorsal region | 9.56 | |
| 5.69 | ||||
| Thrap4 | STRv | Striatum ventral region | 18.78 | |
| 9.55 | ||||
| Thrap4 | TH | Thalamus | 10.93 | |
| 6.68 |
| Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
|---|---|---|---|---|---|
| PAp00025965 | 30 | 539 | 568 | ILNPDHPCFRPDSTKVESLVALLNNSSEMK | Peptide Atlas |



