Annotation Detail for MED24


Gene Symbol: | MED24 ( ARC100,CRSP100,CRSP4,DRIP100,KIAA0130,MGC8748,THRAP4,TRAP100,hTRAP100 ) |
---|---|
Gene Full Name: | mediator complex subunit 24 |
Band: | 17q21.1 |
Quick Links | Entrez ID:9862; OMIM: 607000; Uniprot ID:MED24_HUMAN; ENSEMBL ID: ENSG00000008838; HGNC ID: 22963 |
Relate to Another Database: | SFARIGene; denovo-db |
- Unigene ID: Hs.462983
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
embryoid body | 16 / 70761 | 226 | ![]() |
blastocyst | 11 / 62319 | 176 | ![]() |
fetus | 153 / 564012 | 271 | ![]() |
neonate | 5 / 31097 | 160 | ![]() |
infant | 2 / 23620 | 84 | ![]() |
juvenile | 5 / 55556 | 89 | ![]() |
adult | 306 / 1939121 | 157 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adrenal tumor | 1 / 12794 | 78 | ![]() |
bladder carcinoma | 1 / 17475 | 57 | ![]() |
breast (mammary gland) tumor | 29 / 94178 | 307 | ![]() |
cervical tumor | 1 / 34366 | 29 | ![]() |
chondrosarcoma | 7 / 82823 | 84 | ![]() |
colorectal tumor | 3 / 114246 | 26 | ![]() |
esophageal tumor | 0 / 17290 | 0 | |
gastrointestinal tumor | 15 / 119369 | 125 | ![]() |
germ cell tumor | 134 / 263845 | 507 | ![]() |
glioma | 20 / 106883 | 187 | ![]() |
head and neck tumor | 82 / 136302 | 601 | ![]() |
kidney tumor | 6 / 68959 | 87 | ![]() |
leukemia | 6 / 95842 | 62 | ![]() |
liver tumor | 17 / 96359 | 176 | ![]() |
lung tumor | 7 / 103127 | 67 | ![]() |
lymphoma | 1 / 71755 | 13 | ![]() |
non-neoplasia | 11 / 97250 | 113 | ![]() |
normal | 829 / 3360307 | 246 | ![]() |
ovarian tumor | 1 / 76682 | 13 | ![]() |
pancreatic tumor | 8 / 104616 | 76 | ![]() |
primitive neuroectodermal tumor of the CNS | 10 / 125680 | 79 | ![]() |
prostate cancer | 8 / 102680 | 77 | ![]() |
retinoblastoma | 4 / 46356 | 86 | ![]() |
skin tumor | 32 / 124949 | 256 | ![]() |
soft tissue/muscle tissue tumor | 7 / 125191 | 55 | ![]() |
uterine tumor | 4 / 90257 | 44 | ![]() |
Pool Name | Gene EST/Total EST in pool | Transcripts per million(TPM) | Bar based on TPM |
---|---|---|---|
![]() | |||
adipose tissue | 1 / 13106 | 76 | ![]() |
adrenal gland | 5 / 33197 | 150 | ![]() |
ascites | 3 / 40015 | 74 | ![]() |
bladder | 3 / 29757 | 100 | ![]() |
blood | 8 / 123478 | 64 | ![]() |
bone | 4 / 71655 | 55 | ![]() |
bone marrow | 4 / 48801 | 81 | ![]() |
brain | 594 / 1100989 | 539 | ![]() |
cervix | 1 / 48171 | 20 | ![]() |
connective tissue | 18 / 149255 | 120 | ![]() |
ear | 0 / 16212 | 0 | |
embryonic tissue | 35 / 215722 | 162 | ![]() |
esophagus | 0 / 20209 | 0 | |
eye | 19 / 211054 | 90 | ![]() |
heart | 3 / 89626 | 33 | ![]() |
intestine | 24 / 234472 | 102 | ![]() |
kidney | 20 / 211777 | 94 | ![]() |
larynx | 4 / 24145 | 165 | ![]() |
liver | 22 / 207743 | 105 | ![]() |
lung | 45 / 336974 | 133 | ![]() |
lymph | 1 / 44270 | 22 | ![]() |
lymph node | 13 / 91610 | 141 | ![]() |
mammary gland | 38 / 153271 | 247 | ![]() |
mouth | 74 / 67052 | 1103 | ![]() |
muscle | 7 / 107715 | 64 | ![]() |
nerve | 1 / 15768 | 63 | ![]() |
ovary | 4 / 102051 | 39 | ![]() |
pancreas | 13 / 214812 | 60 | ![]() |
parathyroid | 0 / 20539 | 0 | |
pharynx | 1 / 41328 | 24 | ![]() |
pituitary gland | 1 / 16585 | 60 | ![]() |
placenta | 55 / 280825 | 195 | ![]() |
prostate | 13 / 189345 | 68 | ![]() |
salivary gland | 2 / 20155 | 99 | ![]() |
skin | 36 / 210574 | 170 | ![]() |
spleen | 10 / 53952 | 185 | ![]() |
stomach | 9 / 96619 | 93 | ![]() |
testis | 308 / 330442 | 932 | ![]() |
thymus | 68 / 81131 | 838 | ![]() |
thyroid | 5 / 47473 | 105 | ![]() |
tonsil | 3 / 16999 | 176 | ![]() |
trachea | 57 / 52413 | 1087 | ![]() |
umbilical cord | 4 / 13680 | 292 | ![]() |
uterus | 39 / 232878 | 167 | ![]() |
vascular | 8 / 51780 | 154 | ![]() |
- Microarray Platform: GeneAtlas U133A, gcrma
- Affymatrix Probe ID: 213043_s_at
Cell line | Expression level | Expression bar |
---|---|---|
![]() | ||
721_B_lymphoblasts | 44.2 | ![]() |
Adipocyte | 5.8 | ![]() |
AdrenalCortex | 5.2 | ![]() |
Adrenalgland | 6.5 | ![]() |
Amygdala | 10.55 | ![]() |
Appendix | 5.25 | ![]() |
AtrioventricularNode | 4.35 | ![]() |
BDCA4+_DentriticCells | 25.45 | ![]() |
Bonemarrow | 7 | ![]() |
BronchialEpithelialCells | 77.4 | ![]() |
CD105+_Endothelial | 66.85 | ![]() |
CD14+_Monocytes | 9.35 | ![]() |
CD19+_BCells(neg._sel.) | 10.25 | ![]() |
CD33+_Myeloid | 16.5 | ![]() |
CD34+ | 66.95 | ![]() |
CD4+_Tcells | 16.05 | ![]() |
CD56+_NKCells | 44.8 | ![]() |
CD71+_EarlyErythroid | 43.8 | ![]() |
CD8+_Tcells | 22.9 | ![]() |
CardiacMyocytes | 7.35 | ![]() |
Caudatenucleus | 6 | ![]() |
Cerebellum | 5.85 | ![]() |
CerebellumPeduncles | 8.85 | ![]() |
CiliaryGanglion | 4.75 | ![]() |
CingulateCortex | 9.55 | ![]() |
Colorectaladenocarcinoma | 31.8 | ![]() |
DorsalRootGanglion | 4 | ![]() |
FetalThyroid | 6.7 | ![]() |
Fetalbrain | 15.45 | ![]() |
Fetalliver | 5.65 | ![]() |
Fetallung | 43.55 | ![]() |
GlobusPallidus | 4.7 | ![]() |
Heart | 18.5 | ![]() |
Hypothalamus | 12.95 | ![]() |
Kidney | 5.25 | ![]() |
Leukemia_chronicMyelogenousK-562 | 13.5 | ![]() |
Leukemia_promyelocytic-HL-60 | 9 | ![]() |
Leukemialymphoblastic(MOLT-4) | 40.85 | ![]() |
Liver | 9.7 | ![]() |
Lung | 33.5 | ![]() |
Lymphnode | 6.65 | ![]() |
Lymphoma_burkitts(Daudi) | 16.25 | ![]() |
Lymphoma_burkitts(Raji) | 50.1 | ![]() |
MedullaOblongata | 6.5 | ![]() |
OccipitalLobe | 7 | ![]() |
OlfactoryBulb | 6.05 | ![]() |
Ovary | 3.9 | ![]() |
Pancreas | 7.15 | ![]() |
PancreaticIslet | 7.4 | ![]() |
ParietalLobe | 7.55 | ![]() |
Pituitary | 7.25 | ![]() |
Placenta | 10.45 | ![]() |
Pons | 5.6 | ![]() |
PrefrontalCortex | 16.3 | ![]() |
Prostate | 13.85 | ![]() |
Salivarygland | 4.85 | ![]() |
SkeletalMuscle | 7.75 | ![]() |
Skin | 4.4 | ![]() |
SmoothMuscle | 6.7 | ![]() |
Spinalcord | 7.35 | ![]() |
SubthalamicNucleus | 5.95 | ![]() |
SuperiorCervicalGanglion | 5.6 | ![]() |
TemporalLobe | 5.25 | ![]() |
Testis | 12.45 | ![]() |
TestisGermCell | 18 | ![]() |
TestisIntersitial | 6.95 | ![]() |
TestisLeydigCell | 7 | ![]() |
TestisSeminiferousTubule | 8.7 | ![]() |
Thalamus | 7.45 | ![]() |
Thymus | 21.3 | ![]() |
Thyroid | 15.45 | ![]() |
Tongue | 6.3 | ![]() |
Tonsil | 6.5 | ![]() |
Trachea | 7.95 | ![]() |
TrigeminalGanglion | 4.5 | ![]() |
Uterus | 10.7 | ![]() |
UterusCorpus | 5.95 | ![]() |
WholeBlood | 6.7 | ![]() |
Wholebrain | 14.75 | ![]() |
colon | 7.45 | ![]() |
pineal_day | 34.3 | ![]() |
pineal_night | 27.24 | ![]() |
retina | 13.975 | ![]() |
small_intestine | 9.45 | ![]() |
- Probe name: A_23_P124760
- Donor H0351.2001
- Sex: Male Age: 24 years Race/Ethnicity: African American Handedness: Left
- Tissue Receipt Date: 7/29/2009 Serology: Pass Tissue pH :6.72 Additional Medical Information :History of asthma
- Postmortem Interval: 23 hours (estimated time of death to time that tissue is frozen)
- Toxicology: Positive for atropine and caffeine, at levels usually not toxicologically significant
Tissue | Expression(mean ± stddev) | Expression Bar |
---|---|---|
Amygdala | 5.77 ± 0.39 | ![]() ![]() ![]() |
Basal Forebrain | 5.59 ± 0.33 | ![]() ![]() ![]() |
Basal Part of Pons | 5.89 ± 0.38 | ![]() ![]() ![]() |
Cerebellar Cortex | 5.84 ± 0.4 | ![]() ![]() ![]() |
Cerebellar Nuclei | 5.97 ± 0.41 | ![]() ![]() ![]() |
Claustrum | 5.81 ± 0.45 | ![]() ![]() ![]() |
Epithalamus | 5.35 ± 0.25 | ![]() ![]() ![]() |
Frontal Lobe | 5.84 ± 0.41 | ![]() ![]() ![]() |
Globus Pallidus | 5.38 ± 0.33 | ![]() ![]() ![]() |
Hypothalamus | 5.45 ± 0.51 | ![]() ![]() ![]() |
Insula | 5.91 ± 0.32 | ![]() ![]() ![]() |
Limbic Lobe | 5.74 ± 0.35 | ![]() ![]() ![]() |
Mesencephalon | 5.66 ± 0.41 | ![]() ![]() ![]() |
Myelencephalon | 5.76 ± 0.41 | ![]() ![]() ![]() |
Occipital Lobe | 5.4 ± 0.32 | ![]() ![]() ![]() |
Parietal Lobe | 5.64 ± 0.3 | ![]() ![]() ![]() |
Pontine Tegmentum | 5.61 ± 0.41 | ![]() ![]() ![]() |
Striatum | 5.42 ± 0.35 | ![]() ![]() ![]() |
Subthalamus | 5.87 ± 0.29 | ![]() ![]() ![]() |
Temporal Lobe | 5.9 ± 0.38 | ![]() ![]() ![]() |
Thalamus | 5.82 ± 0.46 | ![]() ![]() ![]() |
White Matter | 5.38 ± 0.35 | ![]() ![]() ![]() |
Gene Symbol | Brain Structure ID | Brain Structure Name | Express Desity/Level (Meatured by ISH) | Express Bar |
---|---|---|---|---|
Thrap4 | CB | Cerebellum | 16.95 | ![]() |
13.46 | ![]() | |||
Thrap4 | CTX | Cerebral cortex | 48.12 | ![]() |
33.69 | ![]() | |||
Thrap4 | HIP | Hippocampal region | 55.75 | ![]() |
50.09 | ![]() | |||
Thrap4 | HPF | Hippocampal formation | 55.49 | ![]() |
45.61 | ![]() | |||
Thrap4 | HY | Hypothalamus | 5.39 | ![]() |
3.18 | ![]() | |||
Thrap4 | LSX | Lateral septal complex | 6.42 | ![]() |
3.56 | ![]() | |||
Thrap4 | MB | Midbrain | 7.67 | ![]() |
4.92 | ![]() | |||
Thrap4 | MY | Medulla | 18.92 | ![]() |
13.86 | ![]() | |||
Thrap4 | OLF | Olfactory bulb | 62.42 | ![]() |
43.7 | ![]() | |||
Thrap4 | P | Pons | 11.69 | ![]() |
8.29 | ![]() | |||
Thrap4 | PAL | Pallidum | 6.84 | ![]() |
4.58 | ![]() | |||
Thrap4 | RHP | Retrohippocampal region | 55.26 | ![]() |
39.86 | ![]() | |||
Thrap4 | sAMY | Striatum-like amygdalar nuclei | 10.58 | ![]() |
6.35 | ![]() | |||
Thrap4 | STR | Striatum | 11.29 | ![]() |
6.52 | ![]() | |||
Thrap4 | STRd | Striatum dorsal region | 9.56 | ![]() |
5.69 | ![]() | |||
Thrap4 | STRv | Striatum ventral region | 18.78 | ![]() |
9.55 | ![]() | |||
Thrap4 | TH | Thalamus | 10.93 | ![]() |
6.68 | ![]() |
Peptide Name | Peptide Lengh | Peptide Start | Peptide End | Peptide Sequence | Source |
---|---|---|---|---|---|
PAp00025965 | 30 | 539 | 568 | ILNPDHPCFRPDSTKVESLVALLNNSSEMK | Peptide Atlas |