AutismKB 2.0

Evidence Details for C11orf94


View Evidences View Variants View Annotations
Basic Information Top
Gene Symbol:C11orf94 ( - )
Gene Full Name: chromosome 11 open reading frame 94
Band: 11p11.2
Quick LinksEntrez ID:143678; OMIM: NA; Uniprot ID:CK094_HUMAN; ENSEMBL ID: ENSG00000234776; HGNC ID: 37213
Relate to Another Database: SFARIGene; denovo-db
Sequences Top
>C11orf94|143678|nucleotide
ATGGTTCTCGCCATGCTGGGGGCTCTGCACCCCCGGGCTGGGCTCAGCCTCTTCCTCCACCTCATCCTGGCAGTGGCACTGCTTCGCTCCCAGCCTCTGAGGTCT
CAGCGGTCTGTTCCTGAGGCATTTTCCGCCCCCCTGGAACTCTCGCAGCCACTTTCCGGCCTGGTGGATGACTATGGCATCCTCCCCAAGCACCCAAGGCCGCGA
GGGCCTCGACCCCTCCTGTCTAGGGCCCAGCAGCGCAAGCGGGACGGGCCCGACCTTGCCGAGTATTACTATGATGCACACCTATGA








Show »

>C11orf94|143678|protein
MVLAMLGALHPRAGLSLFLHLILAVALLRSQPLRSQRSVPEAFSAPLELSQPLSGLVDDYGILPKHPRPRGPRPLLSRAQQRKRDGPDLAEYYYDAHL




Show »

Evidence summary Top

Click the link of the category-specific score to view different category of evidences. The categories without any evidences are hidden by default.
Evidences Syndromic Gene GWAS CNV Linkage Association Expression NGS de novo NGS Mosaic NGS Other Low-Scale Gene Studies Total
Score (No. of Studies) No 0 (0) 0 (0) 1 (2) 0 (0) 0 (0) 0 (0) 0 (0) 0 (0) 0 (0) 2 (2)
Syndromic Autism Gene Top
Genome-Wide Association Studies(By Ethnic Group) Top
CNV Studies Top
Linkage Studies Top
Reference Source Method ADI-R ADOS Diagnosis Family Individual
Total Simplex Multiplex Control Affected Control Total
Yonan, 2003 USA microsatellite-based genomic screenPDD 345 - 345 - - - -
Spence, 2006 USA microsatellite-based genomic screenASD 133 - 133 - 280 - -
Low Scale Association Studies (by Ethnic Group) Top
Large Scale Expression Studies Top
NGS de novo Mutation Studies Top
NGS Mosaic SNV Studies Top
NGS Other Studies Top
Low Scale Gene Studies Top

Contact Us if you are an author of a study regarding this gene and do not find your study in this table or find errors in the representation of your study details.

Simple Query:


  (e.g. CHD8)

Syndromic Genes

Non-syndromic Genes

AutismKB Statistics

  • Studies: 1,036
  • Genes: 1,379
  • CNVs/SVs: 5,420
  • SNVs/Indels: 11,669
  • de novo Mutations: 5,669
  • Mosaics: 789
  • Linkage Regions: 172
  • Paper Collected: 6/30/2018
  • Last Update: 8/26/2018