AutismKB 2.0

Evidence Details for ZFR2


View Evidences View Variants View Annotations
Basic Information Top
Gene Symbol:ZFR2 ( KIAA1086 )
Gene Full Name: zinc finger RNA binding protein 2
Band: 19p13.3
Quick LinksEntrez ID:23217; OMIM: NA; Uniprot ID:ZFR2_HUMAN; ENSEMBL ID: ENSG00000105278; HGNC ID: 29189
Relate to Another Database: SFARIGene; denovo-db
Sequences Top
>ZFR2|23217|nucleotide
ATGGCGACGAGTCAGTATTTCGACTTCGCGCAGGGCGGCGGCCCGCAGTACAGTCCAGAAGTGGAGACCACTCCCCCGGCCCTTGCATCTGGGCTTCCTTGTGCC
CTGCCTTGGACAGTTGGCTGCAGTGGAAGTGACGCTGTGACTGCCCTGTGCCCAAGCTTAAGAGGCCTTGCCTGCATCTGCTCCATCTTATGGGACCCTGCCTGG
TGA








Show »

>ZFR2|23217|protein
MATSQYFDFAQGGGPQYSPEVETTPPALASGLPCALPWTVGCSGSDAVTALCPSLRGLACICSILWDPAW




Show »

Evidence summary Top

Click the link of the category-specific score to view different category of evidences. The categories without any evidences are hidden by default.
Evidences Syndromic Gene GWAS CNV Linkage Association Expression NGS de novo NGS Mosaic NGS Other Low-Scale Gene Studies Total
Score (No. of Studies) No 0 (0) 1 (3) 1 (1) 0 (0) 0 (0) 1 (2) 0 (0) 0 (0) 0 (0) 14 (6)
Syndromic Autism Gene Top
Genome-Wide Association Studies(By Ethnic Group) Top
CNV Studies Top
Reference Source Method ADI-R ADOS Diagnosis Family Individual
Total Simplex Multiplex Control Affected Control Total
Gregory, 2009 USA aCGHASD - - - - 119 54 173
Bucan, 2009 USA SNP microarrayautism, ASD 912 - 912 - - 1488 1488
Levy, 2011 Simons Simplex Collection aCGH--ASD 915 915 - - - - -
Linkage Studies Top
Reference Source Method ADI-R ADOS Diagnosis Family Individual
Total Simplex Multiplex Control Affected Control Total
Schellenberg, 2006 USA microsatellite-based genomic screenautism 222 - 222 - - - -
Low Scale Association Studies (by Ethnic Group) Top
Large Scale Expression Studies Top
NGS de novo Mutation Studies Top
Reference Case Number Family Number de novo Number Title
De Rubeis S, 2014 2270 - 1702 Synaptic, transcriptional and chromatin genes disrupted in autism
Iossifov I, 2014 2508 - 1194 The contribution of de novo coding mutations to autism spectrum disorder.
NGS Mosaic SNV Studies Top
NGS Other Studies Top
Low Scale Gene Studies Top

Contact Us if you are an author of a study regarding this gene and do not find your study in this table or find errors in the representation of your study details.

Simple Query:


  (e.g. CHD8)

Syndromic Genes

Non-syndromic Genes

AutismKB Statistics

  • Studies: 1,036
  • Genes: 1,379
  • CNVs/SVs: 5,420
  • SNVs/Indels: 11,669
  • de novo Mutations: 5,669
  • Mosaics: 789
  • Linkage Regions: 172
  • Paper Collected: 6/30/2018
  • Last Update: 8/26/2018