Evidence Details for HIST1H2BD
Basic Information Top
Gene Symbol: | HIST1H2BD ( H2B.1B,H2B/b,H2BFB,HIRIP2,MGC90432,dJ221C16.6 ) |
---|---|
Gene Full Name: | histone cluster 1, H2bd |
Band: | 6p22.2 |
Quick Links | Entrez ID:3017; OMIM: 602799; Uniprot ID:H2B1D_HUMAN; ENSEMBL ID: ENSG00000158373; HGNC ID: 4747 |
Relate to Another Database: | SFARIGene; denovo-db |
Sequences Top
>HIST1H2BD|3017|nucleotide
ATGCCTGAACCTACCAAGTCTGCTCCTGCCCCAAAGAAGGGCTCCAAGAAGGCGGTGACTAAGGCTCAGAAGAAGGACGGGAAGAAGCGCAAGCGCAGCCGCAAG
GAGAGCTATTCAGTGTATGTGTACAAGGTGCTGAAGCAGGTCCATCCCGACACCGGCATCTCTTCCAAGGCAATGGGGATCATGAATTCCTTCGTCAACGACATC
TTCGAGCGCATCGCAGGCGAGGCTTCCCGCCTGGCGCATTACAACAAGCGCTCGACCATCACCTCCAGGGAGATCCAGACGGCCGTGCGCCTGCTGCTTCCGGGG
GAGCTGGCCAAGCACGCCGTGTCGGAGGGCACCAAGGCCGTCACCAAGTACACCAGTTCCAAGTAA
Show »
ATGCCTGAACCTACCAAGTCTGCTCCTGCCCCAAAGAAGGGCTCCAAGAAGGCGGTGACTAAGGCTCAGAAGAAGGACGGGAAGAAGCGCAAGCGCAGCCGCAAG
GAGAGCTATTCAGTGTATGTGTACAAGGTGCTGAAGCAGGTCCATCCCGACACCGGCATCTCTTCCAAGGCAATGGGGATCATGAATTCCTTCGTCAACGACATC
TTCGAGCGCATCGCAGGCGAGGCTTCCCGCCTGGCGCATTACAACAAGCGCTCGACCATCACCTCCAGGGAGATCCAGACGGCCGTGCGCCTGCTGCTTCCGGGG
GAGCTGGCCAAGCACGCCGTGTCGGAGGGCACCAAGGCCGTCACCAAGTACACCAGTTCCAAGTAA
Show »
>HIST1H2BD|3017|protein
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPG
ELAKHAVSEGTKAVTKYTSSK
Show »
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPG
ELAKHAVSEGTKAVTKYTSSK
Show »
Evidence summary Top
Click the link of the category-specific score to view different category of evidences. The categories without any evidences are hidden by default.
Evidences | Syndromic Gene | GWAS | CNV | Linkage | Association | Expression | NGS de novo | NGS Mosaic | NGS Other | Low-Scale Gene Studies | Total |
---|---|---|---|---|---|---|---|---|---|---|---|
Score (No. of Studies) | No | 0 (0) | 0 (2) | 1 (1) | 0 (0) | 2 (2) | 0 (0) | 0 (0) | 0 (0) | 0 (0) | 4 (5) |
Syndromic Autism Gene Top
Genome-Wide Association Studies(By Ethnic Group) Top
CNV Studies Top
Reference | Source | Method | ADI-R | ADOS | Diagnosis | Family | Individual | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Total | Simplex | Multiplex | Control | Affected | Control | Total | ||||||
Pinto, 2010 | - | SNP microarray, qPCR | ASD | - | - | - | - | 996 | 1287 | 2283 | ||
Levy, 2011 | Simons Simplex Collection | aCGH | - | - | ASD | 915 | 915 | - | - | - | - | - |
Linkage Studies Top
Reference | Source | Method | ADI-R | ADOS | Diagnosis | Family | Individual | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Total | Simplex | Multiplex | Control | Affected | Control | Total | ||||||
Guerini, 2010 | Italy | microsatellite-based genomic screen, SNP-based genomic screen | ASD | 61 | 61 | - | - | 61 | 149 | 210 |
Low Scale Association Studies (by Ethnic Group) Top
Large Scale Expression Studies Top
Microarray Studies: 2
Reference | Source | Tissue | #Subjects (% Women) |
ADI-R | ADOS | Endo- pheno | Diagnosis | Normal Controls (% Women) |
Fold Change | Up/ Down | P/Q value | |
---|---|---|---|---|---|---|---|---|---|---|---|---|
Voineagu, 2011_1 | Unknown | 16 frontal cortex(BA9) and 13 temporal cortex(BA41 | 16 (25.00%) | - | autism | 16 (6.25%) |
1.42755 | Up | - | |||
| ||||||||||||
Voineagu, 2011_2 | Unknown | frontal, BA44/45 | 10 (0.00%) | - | autism | 6 (0.00%) |
1.89421 | Up | 0.0000787 | |||
|
Proteomics Studies:0
Reference | Source | Tissue | Platform | #Subjects (% Women) |
ADI-R | ADOS | Diagnosis | Normal Controls(% Women) | |
---|---|---|---|---|---|---|---|---|---|
No Evidence. |
NGS de novo Mutation Studies Top
NGS Mosaic SNV Studies Top
NGS Other Studies Top
Low Scale Gene Studies Top
Contact Us if you are an author of a study regarding this gene and do not find your study in this table or find errors in the representation of your study details.