Evidence Details for SPANXN5
Basic Information Top
| Gene Symbol: | SPANXN5 ( CT11.10,SPANX-N5 ) |
|---|---|
| Gene Full Name: | SPANX family, member N5 |
| Band: | Xp11.22 |
| Quick Links | Entrez ID:494197; OMIM: 300668; Uniprot ID:SPXN5_HUMAN; ENSEMBL ID: ENSG00000204363; HGNC ID: 33178 |
| Relate to Another Database: | SFARIGene; denovo-db |
Sequences Top
>SPANXN5|494197|nucleotide
ATGGAAAAGCCCACTTCAAGCACCAATGGGGAGAAGAGGAAGAGCCCCTGTGACTCCAACAGCAAAAATGATGAGATGCAGGAGACACCAAACAGGGACTTAGTC
CTCGAACCGAGTTTGAAAAAGATGAAAACATCAGAATATTCAACAGTATTAGTGTTGTGCTACAGGAAGACTAAGAAAATACATTCAAATCAACTGGAGAATGAC
CAGTCCTGA
Show »
ATGGAAAAGCCCACTTCAAGCACCAATGGGGAGAAGAGGAAGAGCCCCTGTGACTCCAACAGCAAAAATGATGAGATGCAGGAGACACCAAACAGGGACTTAGTC
CTCGAACCGAGTTTGAAAAAGATGAAAACATCAGAATATTCAACAGTATTAGTGTTGTGCTACAGGAAGACTAAGAAAATACATTCAAATCAACTGGAGAATGAC
CAGTCCTGA
Show »
>SPANXN5|494197|protein
MEKPTSSTNGEKRKSPCDSNSKNDEMQETPNRDLVLEPSLKKMKTSEYSTVLVLCYRKTKKIHSNQLENDQS
Show »
MEKPTSSTNGEKRKSPCDSNSKNDEMQETPNRDLVLEPSLKKMKTSEYSTVLVLCYRKTKKIHSNQLENDQS
Show »
Evidence summary Top
Click the link of the category-specific score to view different category of evidences. The categories without any evidences are hidden by default.
| Evidences | Syndromic Gene | GWAS | CNV | Linkage | Association | Expression | NGS de novo | NGS Mosaic | NGS Other | Low-Scale Gene Studies | Total |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Score (No. of Studies) | No | 0 (0) | 1 (3) | 0 (0) | 0 (0) | 0 (0) | 0 (0) | 0 (0) | 0 (0) | 0 (0) | 2 (3) |
Syndromic Autism Gene Top
Genome-Wide Association Studies(By Ethnic Group) Top
CNV Studies Top
| Reference | Source | Method | ADI-R | ADOS | Diagnosis | Family | Individual | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Total | Simplex | Multiplex | Control | Affected | Control | Total | ||||||
| Marshall, 2008 | - | SNP microarray | ![]() | ![]() | ASD | 427 | 238 | 189 | - | 427 | 500 | 927 |
| Edens, 2011 | Honduras | aCGH | ![]() | ![]() | autism | - | - | - | - | 1 | - | 1 |
| Edens, 2011 | Austria | FISH, aCGH | ![]() | ![]() | autism | - | - | - | - | 1 | - | 1 |
| Edens, 2011 | Honduras | aCGH | ![]() | ![]() | autism | - | - | - | - | 1 | - | 1 |
| Edens, 2011 | Austria | FISH, aCGH | ![]() | ![]() | autism | - | - | - | - | 1 | - | 1 |
Linkage Studies Top
Low Scale Association Studies (by Ethnic Group) Top
Large Scale Expression Studies Top
NGS de novo Mutation Studies Top
NGS Mosaic SNV Studies Top
NGS Other Studies Top
Low Scale Gene Studies Top
Contact Us if you are an author of a study regarding this gene and do not find your study in this table or find errors in the representation of your study details.



