Evidence Details for RPS27L
![](img/hide.gif)
![](img/arrow-up.png)
Gene Symbol: | RPS27L ( - ) |
---|---|
Gene Full Name: | ribosomal protein S27-like |
Band: | 15q22.2 |
Quick Links | Entrez ID:51065; OMIM: 612055; Uniprot ID:RS27L_HUMAN; ENSEMBL ID: ENSG00000185088; HGNC ID: 18476 |
Relate to Another Database: | SFARIGene; denovo-db |
![](img/hide.gif)
![](img/arrow-up.png)
>RPS27L|51065|nucleotide
ATGCCTTTGGCTAGAGATTTACTACATCCGTCCTTGGAAGAGGAAAAGAAAAAACATAAAAAGAAACGCCTAGTACAAAGTCCAAATTCTTACTTTATGGATGTA
AAATGTCCAGGTTGCTACAAGATCACCACGGTTTTCAGCCATGCTCAGACAGTGGTTCTTTGTGTAGGTTGTTCAACAGTGTTGTGCCAGCCTACAGGAGGAAAG
GCCAGACTCACAGAAGGGTGTTCATTTAGAAGAAAGCAACACTAA
Show »
ATGCCTTTGGCTAGAGATTTACTACATCCGTCCTTGGAAGAGGAAAAGAAAAAACATAAAAAGAAACGCCTAGTACAAAGTCCAAATTCTTACTTTATGGATGTA
AAATGTCCAGGTTGCTACAAGATCACCACGGTTTTCAGCCATGCTCAGACAGTGGTTCTTTGTGTAGGTTGTTCAACAGTGTTGTGCCAGCCTACAGGAGGAAAG
GCCAGACTCACAGAAGGGTGTTCATTTAGAAGAAAGCAACACTAA
Show »
>RPS27L|51065|protein
MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Show »
MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Show »
![](img/hide.gif)
![](img/arrow-up.png)
Click the link of the category-specific score to view different category of evidences. The categories without any evidences are hidden by default.
Evidences | Syndromic Gene | GWAS | CNV | Linkage | Association | Expression | NGS de novo | NGS Mosaic | NGS Other | Low-Scale Gene Studies | Total |
---|---|---|---|---|---|---|---|---|---|---|---|
Score (No. of Studies) | No | 0 (0) | 1 (3) | 1 (1) | 0 (0) | 1 (1) | 0 (0) | 0 (0) | 0 (0) | 0 (0) | 5 (5) |
![](img/show.gif)
![](img/arrow-up.png)
![](img/show.gif)
![](img/arrow-up.png)
![](img/hide.gif)
![](img/arrow-up.png)
Reference | Source | Method | ADI-R | ADOS | Diagnosis | Family | Individual | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Total | Simplex | Multiplex | Control | Affected | Control | Total | ||||||
Smith, 2000 | - | FISH | ![]() | ![]() | autism | - | - | - | - | 1 | - | 1 |
Wassink, 2001 | USA | Chromosomal analysis of G-band | ![]() | ![]() | autism | - | - | - | - | 278 | - | 278 |
Szatmari, 2007 | Europe, North America | SNP microarray | ![]() | ![]() | ASD | 1491 | - | - | - | - | - | 0 |
![](img/hide.gif)
![](img/arrow-up.png)
Reference | Source | Method | ADI-R | ADOS | Diagnosis | Family | Individual | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
Total | Simplex | Multiplex | Control | Affected | Control | Total | ||||||
Allen-Brady, 2010 | USA | SNP-based genomic screen | ![]() | ![]() | ASD | 40 | - | 40 | - | 192 | 461 | 653 |
![](img/show.gif)
![](img/arrow-up.png)
![](img/hide.gif)
![](img/arrow-up.png)
Microarray Studies: 1
Reference | Source | Tissue | #Subjects (% Women) |
ADI-R | ADOS | Endo- pheno | Diagnosis | Normal Controls (% Women) |
Fold Change | Up/ Down | P/Q value | |
---|---|---|---|---|---|---|---|---|---|---|---|---|
Kuwano, 2011_2 | Japan | Mother with ASD children | 21 (100.00%) | - | - | - | - | 21 (100.00%) |
-2.17 | Down | 0.00201 | |
|
Proteomics Studies:0
Reference | Source | Tissue | Platform | #Subjects (% Women) |
ADI-R | ADOS | Diagnosis | Normal Controls(% Women) | |
---|---|---|---|---|---|---|---|---|---|
No Evidence. |
![](img/show.gif)
![](img/arrow-up.png)
![](img/show.gif)
![](img/arrow-up.png)
![](img/show.gif)
![](img/arrow-up.png)
![](img/show.gif)
![](img/arrow-up.png)
Contact Us if you are an author of a study regarding this gene and do not find your study in this table or find errors in the representation of your study details.